General Information

    • DRAMP ID

    • DRAMP03693

    • Peptide Name

    • Bactridin-1 (Bact1; Bactridine 1; Arthropods, animals)

    • Source

    • Tityus discrepans (Venezuelan scorpion)

    • Family

    • Belongs to the long (4 C-C) scorpion toxin superfamily Sodiu

    • Gene

    • Not found

    • Sequence

    • KDGYIIEHRGCKYSCFFGTNSWCNTECTLKKGSSGYCAWPACWCYGLPDNVKIFDSNNLKC

    • Sequence Length

    • 61

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus subtillis ICTA-07MIC=22 µM
        Microccocus luteus ATCC 4698MIC=43 µM
        Enterococcus faecalis WHO14 (MIC=34 µM);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Pseudomonas aeruginosa ATCC 27853MIC=77 µM
        Yersinia enterocolitica ATCC 9610MIC=49 µM
        Acinetobacter calcoaceticus ATCC 2305-5MIC=43 µM

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Amidation(Cyclization with a disulfide bond(Cys11 and Cys61))

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys11 and Cys61,Cys15 and Cys37, Cys23 and Cys42, Cys27 and Cys44.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03693 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03693.

Physicochemical Information

    • Formula

    • C306H448N80O89S8

    • Absent Amino Acids

    • MQ

    • Common Amino Acids

    • C

    • Mass

    • 6927.89

    • PI

    • 8.17

    • Basic Residues

    • 8

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +3

    • Boman Index

    • -82.14

    • Hydrophobicity

    • -0.403

    • Aliphatic Index

    • 46.39

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 22960

    • Absorbance 280nm

    • 382.67

    • Polar Residues

    • 31

DRAMP03693

DRAMP03693 chydropathy plot

Comments Information

    • Function

    • Shows antibacterial activity. Modifies membrane sodium permeability on Y.enterocolitica. Is toxic to cockroaches and crabs, but is not to mice. Does not induce haemolysis in human erythrocytes.

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains four disulfide bonds (By similarity) and C- terminal amidation.

Literature Information

  • ·Literature 1

    • Title

    • Antibacterial activity of six novel peptides from Tityus discrepans scorpion venom. A fluorescent probe study of microbial membrane Na+ permeability changes.

    • Reference

    • Toxicon. 2009 Nov;54(6):802-817.

    • Author

    • Díaz P, D'Suze G, Salazar V, Sevcik C, Shannon JD, Sherman NE, Fox JW.
  • ·Literature 2

    • Title

    • Identification and phylogenetic analysis of Tityus pachyurus and Tityus obscurus novel putative Na+-channel scorpion toxins.

    • Reference

    • PLoS One. 2012;7(2):e30478.

    • Author

    • Guerrero-Vargas JA, Mourão CB, Quintero-Hernández V, Possani LD, Schwartz EF.