• DRAMP ID

    • DRAMP04095
    • Peptide Name

    • Cupiennin-1D (spiders, Arthropods, animals)
    • Source

    • Synthetic construct
    • Family

    • Belongs to the cupiennin family
    • Gene

    • Not found
    • Sequence

    • GFGSLFKFLAKKVAKTVAKQAAKQGAKYVANKHMQ
    • Sequence Length

    • 35
    • Protein Existence

    • Synthetic
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.11792701]Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli ATCC 25922MIC=0.31-0.63 µM
        Pseudomonas aeruginosa ATCC 27853 (MIC=0.31-0.63 µM);-
      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus ATCC 29213MIC=0.31-0.63 µM
        Enterococcus faecalis ATCC 29212MIC=1.25-2.50 µM
    • Hemolytic Activity

      • [Swiss_Prot Entry P83622]has hemolytic activity
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C175H285N49O43S
    • Absent Amino Acids

    • CDEIPRW
    • Common Amino Acids

    • K
    • Mass

    • 3795.55
    • PI

    • 10.54
    • Basic Residues

    • 9
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +9
    • Boman Index

    • -29.69
    • Hydrophobicity

    • -0.266
    • Aliphatic Index

    • 67.14
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 43.82
    • Polar Residues

    • 7

DRAMP04095

DRAMP04095 chydropathy plot
    • Function

    • Has antimicrobial activity. Has insecticidal and hemolytic activities. Probably acts by disturbing membrane Function
    • Tissue specificity

    • Expressed by the venom gland.
    • Toxic dose

    • LD50 is 6.4 pmol/mg on Drosophila.
  • ·Literature 1
    • Title

    • Cupiennin 1, a new family of highly basic antimicrobial peptides in the venom of the spider Cupiennius salei (Ctenidae).
    • Reference

    • J Biol Chem. 2002 Mar 29;277(13):11208-11216.
    • Author

    • Kuhn-Nentwig L, Muller J, Schaller J, Walz A, Dathe M, Nentwig W.
  • ·Literature 2
    • Title

    • Characterisation of antibacterial activity of peptides isolated from the venom of the spider Cupiennius salei (Araneae: Ctenidae).
    • Reference

    • Toxicon. 2000 Mar;38(3):373-380.
    • Author

    • Haeberli S, Kuhn-Nentwig L, Schaller J, Nentwig W.