General Information

    • DRAMP ID

    • DRAMP04095

    • Peptide Name

    • Cupiennin-1D (spiders, Arthropods, animals)

    • Source

    • Synthetic construct

    • Family

    • Belongs to the cupiennin family

    • Gene

    • Not found

    • Sequence

    • GFGSLFKFLAKKVAKTVAKQAAKQGAKYVANKHMQ

    • Sequence Length

    • 35

    • Protein Existence

    • Synthetic

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.11792701]Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=0.31-0.63 µM), Pseudomonas aeruginosa ATCC 27853 (MIC=0.31-0.63 µM);
      • Gram-positive bacteria: Staphylococcus aureus ATCC 29213 (MIC=0.31-0.63 µM), Enterococcus faecalis ATCC 29212 (MIC=1.25-2.50 µM).

    • Hemolytic Activity

      • [Swiss_Prot Entry P83622]has hemolytic activity

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04095 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04095.

Physicochemical Information

    • Formula

    • C175H285N49O43S

    • Absent Amino Acids

    • CDEIPRW

    • Common Amino Acids

    • K

    • Mass

    • 3795.55

    • PI

    • 10.54

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +9

    • Boman Index

    • -29.69

    • Hydrophobicity

    • -0.266

    • Aliphatic Index

    • 67.14

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 43.82

    • Polar Residues

    • 7

DRAMP04095

DRAMP04095 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity. Has insecticidal and hemolytic activities. Probably acts by disturbing membrane Function

    • Tissue specificity

    • Expressed by the venom gland.

    • Toxic dose

    • LD50 is 6.4 pmol/mg on Drosophila.

Literature Information

  • ·Literature 1

    • Title

    • Cupiennin 1, a new family of highly basic antimicrobial peptides in the venom of the spider Cupiennius salei (Ctenidae).

    • Reference

    • J Biol Chem. 2002 Mar 29;277(13):11208-11216.

    • Author

    • Kuhn-Nentwig L, Muller J, Schaller J, Walz A, Dathe M, Nentwig W.
  • ·Literature 2

    • Title

    • Characterisation of antibacterial activity of peptides isolated from the venom of the spider Cupiennius salei (Araneae: Ctenidae).

    • Reference

    • Toxicon. 2000 Mar;38(3):373-380.

    • Author

    • Haeberli S, Kuhn-Nentwig L, Schaller J, Nentwig W.