• DRAMP ID

    • DRAMP04501
    • Peptide Name

    • Antimicrobial peptide Def1-2
    • Source

    • Nasonia vitripennis (Parasitic wasp)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • VTCDLLSFGGKVGHSACAANCLSMGKAGGRCNGGVCQCRKTTFGDLWNKRF
    • Sequence Length

    • 51
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04501 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04501.
    • Formula

    • C224H359N71O66S7
    • Absent Amino Acids

    • EIPY
    • Common Amino Acids

    • G
    • Mass

    • 5327.17
    • PI

    • 9.15
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +6
    • Boman Index

    • -63.63
    • Hydrophobicity

    • -0.039
    • Aliphatic Index

    • 55.49
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 117.5
    • Polar Residues

    • 24

DRAMP04501

DRAMP04501 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Identification and characterization of the parasitic wasp Nasonia defensins: positive selection targeting the functional region?
    • Reference

    • Dev Comp Immunol. 2010 Jun;34(6):659-668.
    • Author

    • Gao B, Zhu S.