General Information

    • DRAMP ID

    • DRAMP04501

    • Peptide Name

    • Antimicrobial peptide Def1-2

    • Source

    • Nasonia vitripennis (Parasitic wasp)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • VTCDLLSFGGKVGHSACAANCLSMGKAGGRCNGGVCQCRKTTFGDLWNKRF

    • Sequence Length

    • 51

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04501 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C224H359N71O66S7

    • Absent Amino Acids

    • EIPY

    • Common Amino Acids

    • G

    • Mass

    • 5327.17

    • PI

    • 9.15

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +6

    • Boman Index

    • -63.63

    • Hydrophobicity

    • -0.039

    • Aliphatic Index

    • 55.49

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 117.5

    • Polar Residues

    • 24

DRAMP04501

DRAMP04501 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification and characterization of the parasitic wasp Nasonia defensins: positive selection targeting the functional region?

    • Reference

    • Dev Comp Immunol. 2010 Jun;34(6):659-668.

    • Author

    • Gao B, Zhu S.