• DRAMP ID

    • DRAMP04905
    • Sequence

    • KRCLVGFGKCKDSCLADETQMQHCKAKKCCIG
    • Sequence Length

    • 32
    • Sequence Name

    • Sequence 31 from Patent US 20030176652
    • Source

    • Mus musculus
    • Activity

    • Antimicrobial
    • Patent Type

    • Patent Application
    • Publication Date

    • 2003-9-18
    • Patent Title

    • Human and mouse beta-defensins, antimicrobial peptides.
    • Abstract

    • The present invention employs an iterative application of BLAST and Hidden Markov Model (HMM) based searches which identified 34 beta-defensin genes in the human genome and 48 in the mouse genome. The present invention relates to novel antimicrobial peptides and derivatives thereof as well as the beta-defensin genes encoding the peptides. The invention further relates to methods of use of the peptides including a method of inhibiting microbial growth by administering an effective amount of the peptide alone or in combination with other antimicrobial agents or antibiotics.