-
-
Sequence
- MKCWGKSGRCRTTCKESEVYYILCKTEAKCCVD
-
-
Sequence Name
- Sequence 55 from Patent US 20030176652
-
-
-
-
Patent Type
- Patent Application
-
Publication Date
- 2003-9-18
-
-
Patent Title
- Human and mouse beta-defensins, antimicrobial peptides.
-
Abstract
- The present invention employs an iterative application of BLAST and Hidden Markov Model (HMM) based searches which identified 34 beta-defensin genes in the human genome and 48 in the mouse genome. The present invention relates to novel antimicrobial peptides and derivatives thereof as well as the beta-defensin genes encoding the peptides. The invention further relates to methods of use of the peptides including a method of inhibiting microbial growth by administering an effective amount of the peptide alone or in combination with other antimicrobial agents or antibiotics.