Patent Information

    • DRAMP ID

    • DRAMP17055

    • Sequence

    • RWRQQWSGPGTTKRFPETVLARCVKYTEIH

    • Sequence Length

    • 30

    • Sequence Name

    • Sequence 16 from Patent US 8080633

    • Source

    • Synthetic construct

    • Activity

    • Antimicrobial, Antiviral

    • Patent Type

    • Granted Patent

    • Publication Date

    • 2011-12-20

    • Patent Title

    • Antiviral compositions comprising a multiple branched peptide construct containing human CD38 leukocyte surface antigen polypeptides.

    • Abstract

    • Peptides representing sequences from region 45-74 of the human CD38 leukocyte surface antigen (SEQ ID NO:1) are provided which may be used to inhibit or prevent transmission or replication of the HIV virus. The peptides have from 13 to 30 amino acids and include the amino acid sequence GPGTTK (SEQ ID NO:18) for topical application to inhibit or prevent transmission of the HIV virus.