Patent Information

    • DRAMP ID

    • DRAMP17061

    • Sequence

    • MRGSHHHHHHAIDVIEGRWQEWEQKITALLEQAQIQQEKNEYELQKLDKWASLWEWFG

    • Sequence Length

    • 58

    • Sequence Name

    • Sequence 2 from Patent WO 2002103026

    • Source

    • Synthetic construct

    • Activity

    • Antimicrobial, Antiviral

    • Patent Type

    • Patent Application

    • Publication Date

    • 2002-12-27

    • Patent Title

    • Method for the recombinant production of peptidic antiviral fusion inhibitors, and acetylation of gb41 fragments.

    • Abstract

    • A process for the production of an antifusogenic peptide of a length of about 10 to 50 amino acids in a prokaryotic host cell, characterized in that, under such conditions that inclusion bodies of said non-fusion antifusogenic peptide or said fusion peptide are formed, a) in said host cell there is expressed a nucleic acid encoding said antifusogenic peptide as a non-fusion peptide or encoding a fusion peptide of a length of about 14 to 70 amino acids consisting of said antifusogenic peptide N-terminally linked to a further peptide of a length of about 4 to 30 amino acids; b) said host cell is cultivated; c) said inclusion bodies are recovered and solubilized; d) in the case of said fusion peptide said antifusogenic peptide is cleaved off from said further peptide; and e) said antifusogenic peptide is isolated.