• DRAMP ID

    • DRAMP17209
    • Sequence

    • PIRLSKEKINDLLQRSQGDLTSSQHEIVHFTDVFIAGSGPISCTYARHIIDNTSTTK
    • Sequence Length

    • 57
    • Sequence Name

    • Sequence 4 from Patent US 20020137896
    • Source

    • Synthetic construct
    • Activity

    • Antitumor
    • Patent Type

    • Patent Application
    • Publication Date

    • 2008-1-1
    • Patent Title

    • Antitumor protein and gene encoding same.
    • Abstract

    • An objective of the present invention is to provide an antitumor protein and a gene encoding the same. The specification discloses a protein comprising (a) an amino acid sequence of SEQ ID No.1 or (b) a modified amino acid sequence of SEQ ID No.1 which have antitumor activity wherein one or more amino acids are added and/or inserted into the amino acid sequence of SEQ ID No.1 and/or one or more amino acids in the amino acid sequence of SEQ ID No.1 are substituted and/or deleted.