-
-
Sequence
- GSYPQFMAPGLVLHITGTTRIGTDDQTSVADPTSK
-
-
Sequence Name
- Sequence 15 from Patent US 20020137896
-
Source
- Synthetic construct
-
-
-
Patent Type
- Patent Application
-
Publication Date
- 2008-1-1
-
-
Patent Title
- Antitumor protein and gene encoding same.
-
Abstract
- An objective of the present invention is to provide an antitumor protein and a gene encoding the same. The specification discloses a protein comprising (a) an amino acid sequence of SEQ ID No.1 or (b) a modified amino acid sequence of SEQ ID No.1 which have antitumor activity wherein one or more amino acids are added and/or inserted into the amino acid sequence of SEQ ID No.1 and/or one or more amino acids in the amino acid sequence of SEQ ID No.1 are substituted and/or deleted.