-
-
Sequence
- KKKKKKGGFLGFWRGENGRKTRSAYERMCNILKGK
-
-
Sequence Name
- Sequence 14 from Patent US 20030077289
-
Source
- Synthetic construct
-
-
-
Patent Type
- Patent Application
-
Publication Date
- 2003-4-24
-
-
Patent Title
- Use of cell-penetrating peptides to generate antitumor immunity.
-
Abstract
- The present invention is directed to methods and compositions for enhancing an immune response in an animal to a disease by administering an immune effector cell comprising a cell penetrating peptide associated with an antigen for the disease. In a specific embodiment, the immune effector cell is a dendritic cell comprising a cell penetrating peptide associated with an antitumor antigen for cancer immunotherapy.