• DRAMP ID

    • DRAMP17237
    • Sequence

    • KKKKKKGGFLGFWRGENGRKTRSAYERMCNILKGK
    • Sequence Length

    • 35
    • Sequence Name

    • Sequence 14 from Patent US 20030077289
    • Source

    • Synthetic construct
    • Activity

    • Antitumor
    • Patent Type

    • Patent Application
    • Publication Date

    • 2003-4-24
    • Patent Title

    • Use of cell-penetrating peptides to generate antitumor immunity.
    • Abstract

    • The present invention is directed to methods and compositions for enhancing an immune response in an animal to a disease by administering an immune effector cell comprising a cell penetrating peptide associated with an antigen for the disease. In a specific embodiment, the immune effector cell is a dendritic cell comprising a cell penetrating peptide associated with an antitumor antigen for cancer immunotherapy.