Patent Information

    • DRAMP ID

    • DRAMP17277

    • Sequence

    • MGSSHHHHHHSSGLVPGSHMVRDGYIADDKNCAYFCGRNAYCDDECKKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGKCNGG

    • Sequence Length

    • 86

    • Sequence Name

    • Sequence 3 from Patent US 20060252676

    • Source

    • Scorpion

    • Activity

    • Antitumor

    • Patent Type

    • Patent Application

    • Publication Date

    • 2006-11-9

    • Patent Title

    • Analgesic antitumor peptide from scorpion and method of producing it.

    • Abstract

    • The present invention relates to a peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof having analgesic and antitumor activity, and preparation method and use thereof. The peptide having analgesic and antitumor activity is obtained by extraction, isolation and purification from the scorpion or scorpion venom. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof can be obtained by chemical synthesis method or bioengineering method. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof is used as the analgesic and antitumor drugs.