General Information

    • DRAMP ID

    • DRAMP18114

    • Peptide Name

    • Monocyte chemotactic protein 1B (MCP-1B; Fragment)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the intercrine beta (chemokine CC) family

    • Gene

    • Not found

    • Sequence

    • DAINSPVTCCYTLTSKKISMQRLMSYRRVTSSKCPKEAVIFKTIAGKEICAEPKXXWVQDSISHLDKKNQXPKP

    • Sequence Length

    • 74

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antitumor

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18114 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18114.

Physicochemical Information

    • Formula

    • C351H574N98O101S6

    • Absent Amino Acids

    • Common Amino Acids

    • K

    • Mass

    • 8363.41

    • PI

    • 9.51

    • Basic Residues

    • 14

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +8

    • Boman Index

    • -10000

    • Hydrophobicity

    • -0.5

    • Aliphatic Index

    • 68.51

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8730

    • Absorbance 280nm

    • 119.59

    • Polar Residues

    • 22

DRAMP18114

DRAMP18114 chydropathy plot

Comments Information

    • Function

    • Chemotactic factor that attracts monocytes, but not neutrophilS. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin.##PTM

Literature Information

  • ·Literature 1

    • Title

    • Purification, sequence analysis, and biological characterization of asecond bovine monocyte chemotactic protein-1 (Bo MCP-1B).

    • Reference

    • Biochemistry 33:13406-13412 (1994).

    • Author

    • Proost P., Wuyts A., Lenaerts J.-P., van Damme J.