General Information

    • DRAMP ID

    • DRAMP18197

    • Peptide Name

    • Diapausin-1

    • Source

    • hemolymph, tobacco hornworm, Manduca sexta

    • Family

    • Belongs to the diapausin family of peptides

    • Gene

    • Not found

    • Sequence

    • INNWVRVPPCDQVCSRSNPEKDECCRAHGHAFHAHCNGGMNCYRR

    • Sequence Length

    • 45

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • S. cerevisiae(IC50 12 uM)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18197 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18197.

Physicochemical Information

    • Formula

    • C212H324N76O63S7

    • Absent Amino Acids

    • LT

    • Common Amino Acids

    • C

    • Mass

    • 5169.8

    • PI

    • 8.35

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -13490

    • Hydrophobicity

    • -0.929

    • Aliphatic Index

    • 34.67

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 167.39

    • Polar Residues

    • 17

DRAMP18197

DRAMP18197 chydropathy plot

Comments Information

    • Function

    • Active against FUNGI such as S. cerevisiae (IC50 12 uM) but not bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Characterization and regulation of expression of an antifungal peptide from hemolymph of an insect, Manduca sexta.

    • Reference

    • Dev Comp Immunol.61:258-68(2016)

    • Author

    • Al Souhail Q, Hiromasa Y, Rahnamaeian M, Giraldo MC, Takahashi D, Valent B, Vilcinskas A, Kanost MR.