• DRAMP ID

    • DRAMP18197
    • Peptide Name

    • Diapausin-1
    • Source

    • hemolymph, tobacco hornworm, Manduca sexta
    • Family

    • Belongs to the diapausin family of peptides
    • Gene

    • Unknow
    • Sequence

    • INNWVRVPPCDQVCSRSNPEKDECCRAHGHAFHAHCNGGMNCYRR
    • Sequence Length

    • 45
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Biological Activity

    • Antifungal
    • Target Organism

      • S. cerevisiae(IC50 12 uM)
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP18197 helical wheel diagram
    • Formula

    • C212H324N76O63S7
    • Absent Amino Acids

    • LT
    • Common Amino Acids

    • C
    • Mass

    • 595481
    • PI

    • 8.14
    • Basic Residues

    • 10
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 9
    • Boman Index

    • -13490
    • Hydrophobicity

    • -92.89
    • Aliphatic Index

    • 34.67
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 167.39
    • Polar Residues

    • 17

DRAMP18197

DRAMP18197 chydropathy plot
    • Function

    • Active against FUNGI such as S. cerevisiae (IC50 12 uM) but not bacteria.
  • Literature 1
    • Reference

    • Dev Comp Immunol.61:258-68(2016)
    • Author

    • Al Souhail Q, Hiromasa Y, Rahnamaeian M, Giraldo MC, Takahashi D, Valent B, Vilcinskas A, Kanost MR.
    • Title

    • Characterization and regulation of expression of an antifungal peptide from hemolymph of an insect, Manduca sexta.