General Information
-
DRAMP ID
- DRAMP18197
-
Peptide Name
- Diapausin-1
-
Source
- hemolymph, tobacco hornworm, Manduca sexta
-
Family
- Belongs to the diapausin family of peptides
-
Gene
- Not found
-
Sequence
- INNWVRVPPCDQVCSRSNPEKDECCRAHGHAFHAHCNGGMNCYRR
-
Sequence Length
- 45
-
UniProt Entry
- No entry found
-
Protein Existence
Activity Information
-
Biological Activity
- Antimicrobial, Antifungal
-
Target Organism
- S. cerevisiae(IC50 12 uM)
-
Hemolytic Activity
-
- No hemolysis information or data found in the reference(s) presented in this entry
-
Cytotoxicity
-
- Not included yet
-
Binding Target
- Not found
Structure Information
-
Linear/Cyclic
- Not included yet
-
N-terminal Modification
- Not included yet
-
C-terminal Modification
- Not included yet
-
Nonterminal Modifications and Unusual Amino Acids
- Not included yet
-
Stereochemistry
- Not included yet
-
Structure
- Not found
-
Structure Description
- Not found
-
Helical Wheel Diagram
-
PDB ID
- None
-
Predicted Structure
- There is no predicted structure for DRAMP18197.
Physicochemical Information
-
Formula
- C212H324N76O63S7
Absent Amino Acids
- LT
Common Amino Acids
- C
Mass
- 5169.8
PI
- 8.35
Basic Residues
- 10
Acidic Residues
- 4
Hydrophobic Residues
- 9
Net Charge
- +6
-
Boman Index
- -13490
Hydrophobicity
- -0.929
Aliphatic Index
- 34.67
Half Life
-
- Mammalian:20 hour
- Yeast:30 min
- E.coli:>10 hour
Extinction Coefficient Cystines
- 7365
Absorbance 280nm
- 167.39
Polar Residues
- 17
DRAMP18197
Comments Information
Function
- Active against FUNGI such as S. cerevisiae (IC50 12 uM) but not bacteria.
Literature Information
- ·Literature 1
-
Title
- Characterization and regulation of expression of an antifungal peptide from hemolymph of an insect, Manduca sexta.
-
Pubmed ID
- 26976231
-
Reference
- Dev Comp Immunol.61:258-68(2016)
-
Author
- Al Souhail Q, Hiromasa Y, Rahnamaeian M, Giraldo MC, Takahashi D, Valent B, Vilcinskas A, Kanost MR.
