General Information

    • DRAMP ID

    • DRAMP18200

    • Peptide Name

    • SB Piscidin 6 (fish, animals)

    • Source

    • Morone saxatilis

    • Family

    • Belongs to the defensin family

    • Gene

    • Not found

    • Sequence

    • FFGRLKSMWRGARGGLKAYKYQKDMAKMNKRYGPNWQQGGGQEPPADAQANDQPP

    • Sequence Length

    • 55

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic

    • Target Organism

    • Staphylococcus aureus ATCC 29213(MIC >32.11uM)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18200 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18200.

Physicochemical Information

    • Formula

    • C275H418N84O77S3

    • Absent Amino Acids

    • CHITV

    • Common Amino Acids

    • G

    • Mass

    • 6229.04

    • PI

    • 10.09

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +6

    • Boman Index

    • -13704

    • Hydrophobicity

    • -1.362

    • Aliphatic Index

    • 25.09

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 15470

    • Absorbance 280nm

    • 286.48

    • Polar Residues

    • 15

DRAMP18200

DRAMP18200 chydropathy plot

Comments Information

    • No more comments

Literature Information

  • ·Literature 1

    • Title

    • A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes.

    • Reference

    • PLoS One. 11(8):e0159423(2016)

    • Author

    • Salger SA, Cassady KR, Reading BJ, Noga EJ