• DRAMP ID

    • DRAMP18200
    • Peptide Name

    • SB Piscidin 6 (fish, animals; UCLL1a)
    • Source

    • Morone saxatilis
    • Family

    • Belongs to the defensin family
    • Gene

    • Unknow
    • Sequence

    • FFGRLKSMWRGARGGLKAYKYQKDMAKMNKRYGPNWQQGGGQEPPADAQANDQPP
    • Sequence Length

    • 55
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Biological Activity

    • Anti-Gram+, Antiparasitic
    • Target Organism

      • Staphylococcus aureus ATCC 29213(MIC >32.11uM)
    • Binding Traget

    • Lipid-binding
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP18200 helical wheel diagram
    • Formula

    • C275H418N84O77S3
    • Absent Amino Acids

    • CHITV
    • Common Amino Acids

    • G
    • Mass

    • 719242
    • PI

    • 10.68
    • Basic Residues

    • 10
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 12
    • Boman Index

    • -13704
    • Hydrophobicity

    • -136.18
    • Aliphatic Index

    • 25.09
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 15470
    • Absorbance 280nm

    • 286.48
    • Polar Residues

    • 15
browser doesn't support html5

Amino Acid Distribution

DRAMP18200 chydropathy plot
    • No more comments

  • Literature 1
    • Reference

    • PLoS One. 11(8):e0159423(2016)
    • Author

    • Salger SA, Cassady KR, Reading BJ, Noga EJ
    • Title

    • A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes.