• DRAMP ID

    • DRAMP18201
    • Peptide Name

    • WB Piscidin 6 (fish, animals)
    • Source

    • Morone chrysops
    • Family

    • Belongs to the defensin family
    • Gene

    • Not found
    • Sequence

    • LFGSVKAWFKGAKKGFQDYRYQKDMAKMNKRYGPNWQQRGGQEPPADAQANDQPP
    • Sequence Length

    • 55
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic
    • Target Organism

    • Staphylococcus aureus ATCC 29213(MIC >31.59uM)
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18201 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18201.
    • Formula

    • C283H423N83O80S2
    • Absent Amino Acids

    • CHIT
    • Common Amino Acids

    • KQAG
    • Mass

    • 6332.1
    • PI

    • 9.82
    • Basic Residues

    • 10
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +5
    • Boman Index

    • -14406
    • Hydrophobicity

    • -1.44
    • Aliphatic Index

    • 23.27
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 15470
    • Absorbance 280nm

    • 286.48
    • Polar Residues

    • 13

DRAMP18201

DRAMP18201 chydropathy plot
    • No more comments

  • ·Literature 1
    • Title

    • A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes.
    • Reference

    • PLoS One. 11(8):e0159423(2016)
    • Author

    • Salger SA, Cassady KR, Reading BJ, Noga EJ