General Information

    • DRAMP ID

    • DRAMP18202

    • Peptide Name

    • WB Piscidin 5 (fish, animals)

    • Source

    • Morone chrysops

    • Family

    • Belongs to the defensin family

    • Gene

    • Not found

    • Sequence

    • LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP

    • Sequence Length

    • 46

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic

    • Target Organism

    • Staphylococcus aureus ATCC 29213(MIC 4.52uM)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18202 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18202.

Physicochemical Information

    • Formula

    • C255H398N84O56

    • Absent Amino Acids

    • CDEMNT

    • Common Amino Acids

    • R

    • Mass

    • 5536.49

    • PI

    • 11.84

    • Basic Residues

    • 14

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +14

    • Boman Index

    • -12420

    • Hydrophobicity

    • -0.539

    • Aliphatic Index

    • 78.48

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 12950

    • Absorbance 280nm

    • 287.78

    • Polar Residues

    • 12

DRAMP18202

DRAMP18202 chydropathy plot

Comments Information

    • No more comments

Literature Information

  • ·Literature 1

    • Title

    • A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes.

    • Reference

    • PLoS One. 11(8):e0159423(2016)

    • Author

    • Salger SA, Cassady KR, Reading BJ, Noga EJ