• DRAMP ID

    • DRAMP18202
    • Peptide Name

    • WB Piscidin 5 (fish, animals; UCLL1a)
    • Source

    • Morone chrysops
    • Family

    • Belongs to the defensin family
    • Gene

    • Unknow
    • Sequence

    • LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYP
    • Sequence Length

    • 46
    • Evidence code

    • Biological Activity

    • Anti-Gram+ & Gram-, Antiparasitic
    • Target Organism

      • Staphylococcus aureus ATCC 29213(MIC 4.52uM)
    • Binding Traget

    • Lipid-binding
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP18202 helical wheel diagram
    • Formula

    • C255H398N84O56
    • Absent Amino Acids

    • CDEMNT
    • Common Amino Acids

    • R
    • Mass

    • 633930
    • PI

    • 12.34
    • Basic Residues

    • 14
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 17
    • Boman Index

    • -12420
    • Hydrophobicity

    • -53.91
    • Aliphatic Index

    • 78.48
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 12950
    • Absorbance 280nm

    • 287.78
    • Polar Residues

    • 12
browser doesn't support html5

Amino Acid Distribution

DRAMP18202 chydropathy plot
    • No more comments

  • Literature 1
    • Reference

    • PLoS One. 11(8):e0159423(2016)
    • Author

    • Salger SA, Cassady KR, Reading BJ, Noga EJ
    • Title

    • A Diverse Family of Host-Defense Peptides (Piscidins) Exhibit Specialized Anti-Bacterial and Anti-Protozoal Activities in Fishes.