• DRAMP ID

    • DRAMP18735
    • Sequence

    • AQAEPLQARADEAAAQEQPGADDQEMAHAFTWHESAALPLSDSARGLRCICGRGICRLL
    • Sequence Length

    • 59
    • Sequence Name

    • Sequence 12 from Patent US 20090264344
    • Source

    • Homo sapiens
    • Activity

    • Antimicrobial, Antibacterial, Antiviral
    • Patent Type

    • Patent Application
    • Publication Date

    • 2009-10-22
    • Patent Title

    • Retrocyclins, antiviral and antimicrobial peptides.
    • Abstract

    • Retrocyclin peptides are small antimicrobial agents with potent activity against bacteria and viruses. The peptides are nonhemolytic, and exhibit minimal in vitro cytotoxicity. A pharmaceutical composition comprising retrocyclin as an active agent is administered therapeutically to a patient suffering from a bacterial and/or viral infection, or to an individual facing exposure to a bacterial and/or viral infection, especially one caused by the HIV1 retrovirus or other sexuallytransmitted pathogens.