-
-
Sequence
- AQAEPLQARADEAAAQEQPGADDQEMAHAFTWHESAALPLSDSARGLRCICGRGICRLL
-
-
Sequence Name
- Sequence 12 from Patent US 20090264344
-
-
Activity
- Antimicrobial, Antibacterial, Antiviral
-
-
Patent Type
- Patent Application
-
Publication Date
- 2009-10-22
-
-
Patent Title
- Retrocyclins, antiviral and antimicrobial peptides.
-
Abstract
- Retrocyclin peptides are small antimicrobial agents with potent activity against bacteria and viruses. The peptides are nonhemolytic, and exhibit minimal in vitro cytotoxicity. A pharmaceutical composition comprising retrocyclin as an active agent is administered therapeutically to a patient suffering from a bacterial and/or viral infection, or to an individual facing exposure to a bacterial and/or viral infection, especially one caused by the HIV1 retrovirus or other sexuallytransmitted pathogens.