-
-
Sequence
- KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
-
-
Sequence Name
- Sequence 5 from Patent US 6872705
-
-
-
-
Patent Type
- Granted Patent
-
Publication Date
- 2005-3-29
-
-
Patent Title
- Use Of Antimicrobial Peptides As Preservatives In Ophthalmic Preparations, Including Solutions, Emulsions, And Suspensions
-
Abstract
- Methods for preserving ophthalmic compositions are disclosed. In one embodiment, such compositions include a liquid medium and an antimicrobial component which is preferably substantially nonoxidative. Compositions which include a liquid medium and antimicrobial peptide magainins, present in an amount effective as a preservative, are also disclosed. Preserved compositions useful for administering a therapeutic component to the eyes or caring for contact lenses are also included within the scope of the present invention.