• DRAMP ID

    • DRAMP18898
    • Sequence

    • KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALG
    • Sequence Length

    • 36
    • Sequence Name

    • Sequence 6 from Patent US 6872705
    • Source

    • Bombyx mori
    • Activity

    • Antimicrobial
    • Patent Type

    • Granted Patent
    • Publication Date

    • 2005-3-29
    • Patent Title

    • Use Of Antimicrobial Peptides As Preservatives In Ophthalmic Preparations, Including Solutions, Emulsions, And Suspensions
    • Abstract

    • Methods for preserving ophthalmic compositions are disclosed. In one embodiment, such compositions include a liquid medium and an antimicrobial component which is preferably substantially nonoxidative. Compositions which include a liquid medium and antimicrobial peptide magainins, present in an amount effective as a preservative, are also disclosed. Preserved compositions useful for administering a therapeutic component to the eyes or caring for contact lenses are also included within the scope of the present invention.