Patent Information

    • DRAMP ID

    • DRAMP19142

    • Sequence

    • MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

    • Sequence Length

    • 64

    • Sequence Name

    • Sequence 85 from Patent US 6696238

    • Source

    • Homo sapiens

    • Activity

    • Antimicrobial, Antibacterial

    • Patent Type

    • Granted Patent

    • Publication Date

    • 2004-2-24

    • Patent Title

    • Transplant Media

    • Abstract

    • The present invention relates to media containing purified antimicrobial polypeptides, such as defensins, and/or cell surface receptor binding proteins. The media may also contain buffers, macromolecular oncotic agents, energy sources, impermeant anions, ATP substrates. The media find use for the storage and preservation of internal organs prior to transplant.