• DRAMP ID

    • DRAMP19381
    • Sequence

    • QKLCQRSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
    • Sequence Length

    • 50
    • Sequence Name

    • Sequence 35 from Patent US 6864068
    • Source

    • Raphanus sativus
    • Activity

    • Antimicrobial, Antifungal
    • Patent Type

    • Granted Patent
    • Publication Date

    • 2005-3-8
    • Patent Title

    • Antifungal Proteins
    • Abstract

    • Antifungal proteins which are analogues of the RsAF16 protein and contain particular mutations in their amino acid sequence. The mutated proteins possess enhanced salttolerant antifungal activity. The proteins are useful for combating fungal diseases inҫ