• DRAMP ID

    • DRAMP19397
    • Sequence

    • GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS
    • Sequence Length

    • 44
    • Sequence Name

    • Sequence 128 from Patent US 7932230
    • Source

    • Opistophthalmus carinatus
    • Activity

    • Antimicrobial, Antifungal
    • Patent Type

    • Granted Patent
    • Publication Date

    • 2011-4-26
    • Patent Title

    • Antifungal paints and coatings
    • Abstract

    • Antifungal and antibacterial peptides, polypeptides and proteins as antifungal additives for paint and other coatings are disclosed, along with antifungal compositions, and coated surfaces with antifungal properties. Methods of using the coatings for treating and/or inhibiting growth of mold, mildew and other fungi and bacteria on objects such as building materials that are susceptible to such infestation are also disclosed.