• DRAMP ID

    • DRAMP28614
    • Sequence

    • SIFSLFKMGAKALGKTLLKQAGKAGAEYAACKATNQC
    • Sequence Length

    • 37
    • Sequence Name

    • Sequence 2 from Patent US 20190367567
    • Source

    • Synthetic construct
    • Activity

    • Antimicrobial, Antiviral
    • Patent Type

    • Patent Application
    • Publication Date

    • 2019-12-5
    • Patent Title

    • Peptides And Uses For Managing Viral Infections
    • Abstract

    • It has been discovered that certain peptides are useful for managing certain viral infections. Thus, this disclosure relates to the use of peptides reported herein for the prevention or treatment of viral infections such as influenza infections. In certain embodiments, this disclosure relates to peptides, variants, or derivatives having sequences disclosed herein and pharmaceutical compositions comprising the same.