• DRAMP ID

    • DRAMP28884
    • Sequence

    • QHGYGAGGHGQQGYGSQHSSHAPQGGHVVREQGFSGHVHEQQAGHHHEAGHHEQAGHHEQSGQQVHGQGHGYK
    • Sequence Length

    • 73
    • Sequence Name

    • Sequence 2 from Patent US 10266842
    • Source

    • Lucilia sericata
    • Activity

    • Antimicrobial, Antifungal
    • Patent Type

    • Granted Patent
    • Publication Date

    • 2019-4-23
    • Patent Title

    • Polypeptides Against Plant Pathogenic Fungi
    • Abstract

    • The present invention discloses polypeptides comprising an amino acid sequence being identical with at least 12 contiguous amino acid residues of SEQ ID No 2. The polypeptides according to the invention are effective against fungi, especially against fungi causing plant diseases, and against fungi colonizing agricultural products. The invention further discloses processes for preparing such polypeptides, and nucleic acids coding for such polypeptides. In addition, the invention relates to processes and preparations for treating plants using the polypeptides according to the invention, and to the use of the nucleic acids according to the invention for producing crops that are protected against damage from fungi.