-
-
Sequence
- MSGRGKGGKTKAKAKSRSSRAGLQFPVGRIHRLLRKGNYA
-
-
Sequence Name
- Sequence 5 from Patent US 20200308236
-
-
-
-
Patent Type
- Patent Application
-
Publication Date
- 2020-10-1
-
-
Patent Title
- Stapled Intracellular-targeting Antimicrobial Peptides To Treat Infection
-
Abstract
- Structurally stabilized, e.g., stapled, peptides with the ability to translocate through microbial cell membranes to the interior of microbial cells and exert a biological activity there are provided, as are methods of designing, making and using such peptides.