• DRAMP ID

    • DRAMP28890
    • Sequence

    • MSGRGKGGKTKAKAKSRSSRAGLQFPVGRIHRLLRKGNYA
    • Sequence Length

    • 40
    • Sequence Name

    • Sequence 5 from Patent US 20200308236
    • Source

    • Haliotis discus
    • Activity

    • Antimicrobial
    • Patent Type

    • Patent Application
    • Publication Date

    • 2020-10-1
    • Patent Title

    • Stapled Intracellular-targeting Antimicrobial Peptides To Treat Infection
    • Abstract

    • Structurally stabilized, e.g., stapled, peptides with the ability to translocate through microbial cell membranes to the interior of microbial cells and exert a biological activity there are provided, as are methods of designing, making and using such peptides.