-
-
Sequence
- MFTMKKSLLLLFFLGTISLSLCEQERNADDDQGEVIEQKVKR
-
-
Sequence Name
- Sequence 1 from Patent US 2022/0125873
-
Source
- Synthetic construct
-
-
-
Patent Type
- Patent Application
-
Publication Date
- 2022-4-28
-
-
Patent Title
- Antimicrobial Peptides
-
Abstract
- Antimicrobial peptides (AMPs), small compounds that often exhibitbroad spectrum antimicrobial activity, are garnering interest as potential therapeutics against antibiotic-resistant bacterial pathogens. Development of new AMPs is arduous due to the practical limitations of classical protein-based discovery approaches. A high throughput bioinformatics approach is described which is able to confirm identification of known AMPs from the North American bullfrog ( Rana ( Lithobates ) catesbeiana ) genome, and a bioinformatics approach is used to develop new AMPs. The described AMPs exhibit antimicrobial activity against Mycobacterium smegmatis via microtitre broth dilution assays, indicating broader efficacy.