• DRAMP ID

    • DRAMP29379
    • Sequence

    • MFTLKKSLLLLFFLGTITLSLCEQERGADEEEGNGEKEIKRSMLSVLKNLGKVGLGFVACKINKQC
    • Sequence Length

    • 66
    • Sequence Name

    • Sequence 17 from Patent US 2022/0125873
    • Source

    • Synthetic construct
    • Activity

    • Antimicrobial
    • Patent Type

    • Patent Application
    • Publication Date

    • 2022-4-28
    • Patent Title

    • Antimicrobial Peptides
    • Abstract

    • Antimicrobial peptides (AMPs), small compounds that often exhibitbroad spectrum antimicrobial activity, are garnering interest as potential therapeutics against antibiotic-resistant bacterial pathogens. Development of new AMPs is arduous due to the practical limitations of classical protein-based discovery approaches. A high throughput bioinformatics approach is described which is able to confirm identification of known AMPs from the North American bullfrog ( Rana ( Lithobates ) catesbeiana ) genome, and a bioinformatics approach is used to develop new AMPs. The described AMPs exhibit antimicrobial activity against Mycobacterium smegmatis via microtitre broth dilution assays, indicating broader efficacy.