• DRAMP ID

    • DRAMP29430
    • Sequence

    • SVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH
    • Sequence Length

    • 34
    • Sequence Name

    • Sequence 5 from Patent WO 2023/075675
    • Source

    • Synthetic construct
    • Activity

    • Antimicrobial, Antibacterial
    • Patent Type

    • Patent Application
    • Publication Date

    • 2023-5-4
    • Patent Title

    • Antibacterial Peptide
    • Abstract

    • The present document is directed to an antimicrobial peptide, pharmaceutical and non- pharmaceutical compositions comprising an amino acid sequence as set forth in SEQ ID NO: 1 or SEQ ID NO: 2 or an amino acid sequence having at least 85% or at least 90%, sequence identity to SEQ ID NO: 1 or SEQ ID NO: 2, and medical and non- medical use the antimicrobial peptide