• DRAMP ID

    • DRAMP18090
    • Sequence

    • [LL-37, 37 aa]
    • Sequence Name

    • LL-37
    • Description

    • Human (neutrophils and epithelial cells)
    • Activity

    • Antibacterial(Monocyte,T-cell, neutrophil chemotaxis)
    • Medical use

    • Staphylococus aureusanti-infectives
    • Stage of Development

    • Preclinical
    • Comments

    • No more comments
    • Company

    • Inimex Pharmaceuticals
    • Target Organism

      • No MICs found on DRAMP database
    • Reference

      • Not available