Sequence Information

    • DRAMP ID

    • DRAMP18090

    • Name

    • LL-37(Cathelicidin, ropocamptide, Bac4, CAS001)

    • Sequence

    • [LL-37, 37 aa]

    • Description

    • Human (neutrophils and epithelial cells)

    • Activity

    • Antibacterial(Monocyte,T-cell, neutrophil chemotaxis)

    • Target Organism

      • No MICs found on DRAMP database

    • Reference

      • Not available

Clinical Information

    • Medical use

    • Hard-to-heal venous leg ulcers

    • Company

    • Inimex Pharmaceuticals

    • Stage of Development

    • Phase I/II

    • Comments

    • No more comments

    • Clinical Trials

    • ChiCTR2300067840
    • ChiCTR2200063622
    • ChiCTR2200060982
    • ChiCTR2000030939