Result: 1 - 20 of 156
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP02980Antimicrobial peptide NK-lysin (NKL; pigs, mammals, animals)GLICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKESus scrofa (Pig)Antibacterial, Antifungal, Antitumor, Antimicrobial7737114,9334742
DRAMP03215Gomesin (Gm; spiders, Arthropods, animals)ZCRRLCYKQRCVTYCRGRAcanthoscurria gomesiana (Tarantula spider)Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial, Antitumor10942757,28741926
DRAMP01274Kunitz-type serine protease inhibitor PIVL; QDRPKFCYLPADPAECNAYMPRFYYDSASNKCKEFIYGGCRGNANNFKNRAECRHTCVASMacrovipera lebetina transmediterranea (Blunt-nosed viper) (Viperalebetina transmediterranea)Antitumor23262217
DRAMP02459L-amino-acid oxidase (BjarLAAO-I; LAAO; LAO; snakes, reptils, animals)ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVVBothrops jararaca (Jararaca)Antibacterial, Antiparasitic, Antitumor, Anti-Gram+, Antimicrobial18346051,19101583,20615423
DRAMP02465L-amino-acid oxidase L1 (LAAO; LAAO-L1; LAO; Reptiles, animals)ADDINPKEECFFEDDYYEFEDaboia russelii (Russel's viper) (Vipera russelii)Antibacterial, Antiparasitic, Antitumor, Antimicrobial18384385,20203422
DRAMP02466L-amino-acid oxidase L2 (LAAO; LAAO-L2; LAO; Reptiles, animals)ADDKNPLEECFCEDDDYCEGDaboia russelii (Russel's viper) (Vipera russelii)Antibacterial, Antiparasitic, Antitumor, Antimicrobial18384385
DRAMP02467L-amino-acid oxidase (LAAO; LAO; Reptiles, animals)ADDKNPLEECFREDDYEEFLEIAKNGLKKTSNPKHIVYPVKPSEQLYEESLRDQLPTSMHRYPSMIQKIFFAGEYTANAHGWIDSTIKVipera berus berus (Common viper)Antibacterial, Antiparasitic, Antitumor, Antimicrobial16574513
DRAMP02488L-amino-acid oxidase ACTX-8 (LAAO; LAO; Snakes, reptiles, animals)ADDRNPLEEFRENNYEEFLDeinagkistrodon acutus (Hundred-pace snake) (Agkistrodon acutus)Antibacterial, Antiparasitic, Antitumor, Antimicrobial17275856
DRAMP03064Alloferon-1 (Insects, animals)HGVSGHGQHGVHGCalliphora vicina (Blue blowfly) (Calliphora erythrocephala)Antiparasitic, Antiviral, Antitumor, Antimicrobial12235362
DRAMP15717Sequence 1 from Patent US 20070293424HGVSGWGQHGTHGSynthetic constructAntitumor, AntiviralUS 2007/0293424 A1
DRAMP15718Sequence 2 from Patent US 20070293424HGGGWGQPHGGGTragelaphus strepsicerosAntitumor, AntiviralUS 2007/0293424 A1
DRAMP15719Sequence 3 from Patent US 20070293424GGGGWGQGGTHGTragelaphus strepsicerosAntitumor, AntiviralUS 2007/0293424 A1
DRAMP15720Sequence 4 from Patent US 20070293424GGGWGQPHVGGTragelaphus strepsicerosAntitumor, AntiviralUS 2007/0293424 A1
DRAMP15721Sequence 5 from Patent US 20070293424VGGWGQPHGGGTragelaphus strepsicerosAntitumor, AntiviralUS 2007/0293424 A1
DRAMP15722Sequence 8 from Patent US 20070293424GGGWGQPHGGGBos taurusAntitumor, AntiviralUS 2007/0293424 A1
DRAMP15723Sequence 9 from Patent US 20070293424QGGGGWGQPHGGGWGHomo sapiensAntitumor, AntiviralUS 2007/0293424 A1
DRAMP15724Sequence 10 from Patent US 20070293424HGGGWGQPHGGGWGHomo sapiensAntitumor, AntiviralUS 2007/0293424 A1
DRAMP15725Sequence 11 from Patent US 20070293424HGGGWGQGGGTHSHomo sapiensAntitumor, AntiviralUS 2007/0293424 A1
DRAMP15726Sequence 12 from Patent US 20070293424HGVSGHGQHGVHGCalliphora vicinaAntitumor, AntiviralUS 2007/0293424 A1
DRAMP17476Sequence 1 from Patent US 4529594SASRALSDKPLAHVVANPQVEGQLQWLSynthetic constructAntitumorUS 4529594 A
Close
Sign in     login

Forgot your password?