Result: 1 - 20 of 177
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP02980Antimicrobial peptide NK-lysin (NKL; pigs, mammals, animals)GLICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKESus scrofa (Pig)Antimicrobial, Antibacterial, Antifungal, Antitumor7737114,9334742
DRAMP03215Gomesin (Gm; spiders, Arthropods, animals)ZCRRLCYKQRCVTYCRGRAcanthoscurria gomesiana (Tarantula spider)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antitumor10942757,28741926
DRAMP03967P18 (Cecropin A(1-8)-Magainin 2(1−12) hybrid peptide analogue)KWKLFKKIPKFLHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420,12370027
DRAMP03968[L9]-P18 (analog of P18)KWKLFKKILKFLHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03969[S9]-P18 (analog of P18)KWKLFKKISKFLHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03970N-1 (analog of P18)WKLFKKIPKFLHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03971N-2 (analog of P18)FKLFKKIPKFLHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03972N-3 (analog of P18)KWFKKIPKFLHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03973N-4 (analog of P18)WFKKIPKFLHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03974N-5 (analog of P18)WKKIPKFLHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03975N-3L (analog of P18)KWFKKIPKFLHLLKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03976N-4L (analog of P18)WFKKIPKFLHLLKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03977N-5L (analog of P18)WKKIPKFLHLLKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03978C-1 (analog of P18)KWKLFKKIPFLHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03979C-2 (analog of P18)KWKLFKKIPKFLHLAKKSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03980C-3 (analog of P18)KWKLFKKIPLHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03981C-4 (analog of P18)KWKLFKKIPKFLHLAKSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03982C-5 (analog of P18)KWKLFKKIPHLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03983C-6 (analog of P18)KWKLFKKIPKFLHLASynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
DRAMP03984C-7 (analog of P18)KWKLFKKIPLAKKFSynthetic constructAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antitumor12005420
Close
Sign in     login

Forgot your password?