Result: 1 - 20 of 140
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP02980Antimicrobial peptide NK-lysin (NKL; pigs, mammals, animals)GLICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKESus scrofa (Pig)Antibacterial, Antifungal, Antitumor, Antimicrobial7737114,9334742
DRAMP01274Kunitz-type serine protease inhibitor PIVL; QDRPKFCYLPADPAECNAYMPRFYYDSASNKCKEFIYGGCRGNANNFKNRAECRHTCVASMacrovipera lebetina transmediterranea (Blunt-nosed viper) (Viperalebetina transmediterranea)Antitumor23262217
DRAMP02459L-amino-acid oxidase (BjarLAAO-I; LAAO; LAO; snakes, reptils, animals)ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVVBothrops jararaca (Jararaca)Antibacterial, Antiparasitic, Antitumor, Anti-Gram+, Antimicrobial18346051,19101583,20615423
DRAMP02465L-amino-acid oxidase L1 (LAAO; LAAO-L1; LAO; Reptiles, animals)ADDINPKEECFFEDDYYEFEDaboia russelii (Russel's viper) (Vipera russelii)Antibacterial, Antiparasitic, Antitumor, Antimicrobial18384385,20203422
DRAMP02466L-amino-acid oxidase L2 (LAAO; LAAO-L2; LAO; Reptiles, animals)ADDKNPLEECFCEDDDYCEGDaboia russelii (Russel's viper) (Vipera russelii)Antibacterial, Antiparasitic, Antitumor, Antimicrobial18384385
DRAMP02467L-amino-acid oxidase (LAAO; LAO; Reptiles, animals)ADDKNPLEECFREDDYEEFLEIAKNGLKKTSNPKHIVYPVKPSEQLYEESLRDQLPTSMHRYPSMIQKIFFAGEYTANAHGWIDSTIKVipera berus berus (Common viper)Antibacterial, Antiparasitic, Antitumor, Antimicrobial16574513
DRAMP02488L-amino-acid oxidase ACTX-8 (LAAO; LAO; Snakes, reptiles, animals)ADDRNPLEEFRENNYEEFLDeinagkistrodon acutus (Hundred-pace snake) (Agkistrodon acutus)Antibacterial, Antiparasitic, Antitumor, Antimicrobial17275856
DRAMP03064Alloferon-1 (Insects, animals)HGVSGHGQHGVHGCalliphora vicina (Blue blowfly) (Calliphora erythrocephala)Antiparasitic, Antiviral, Antitumor, Antimicrobial12235362
DRAMP15717Sequence 1 from Patent US 20070293424HGVSGWGQHGTHGSynthetic constructAntitumor, AntiviralNo pubmed id
DRAMP15718Sequence 2 from Patent US 20070293424HGGGWGQPHGGGTragelaphus strepsicerosAntitumor, AntiviralNo pubmed id
DRAMP15719Sequence 3 from Patent US 20070293424GGGGWGQGGTHGTragelaphus strepsicerosAntitumor, AntiviralNo pubmed id
DRAMP15720Sequence 4 from Patent US 20070293424GGGWGQPHVGGTragelaphus strepsicerosAntitumor, AntiviralNo pubmed id
DRAMP15721Sequence 5 from Patent US 20070293424VGGWGQPHGGGTragelaphus strepsicerosAntitumor, AntiviralNo pubmed id
DRAMP15722Sequence 8 from Patent US 20070293424GGGWGQPHGGGBos taurusAntitumor, AntiviralNo pubmed id
DRAMP15723Sequence 9 from Patent US 20070293424QGGGGWGQPHGGGWGHomo sapiensAntitumor, AntiviralNo pubmed id
DRAMP15724Sequence 10 from Patent US 20070293424HGGGWGQPHGGGWGHomo sapiensAntitumor, AntiviralNo pubmed id
DRAMP15725Sequence 11 from Patent US 20070293424HGGGWGQGGGTHSHomo sapiensAntitumor, AntiviralNo pubmed id
DRAMP15726Sequence 12 from Patent US 20070293424HGVSGHGQHGVHGCalliphora vicinaAntitumor, AntiviralNo pubmed id
DRAMP17476Sequence 1 from Patent US 4529594SASRALSDKPLAHVVANPQVEGQLQWLSynthetic constructAntitumorNo pubmed id
DRAMP17477Sequence 1 from Patent US 5831002XVXPPVFSynthetic constructAntitumorNo pubmed id
The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk.
Sign in     login

Forgot your password?