Result: 1 - 20 of 293
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00795Cliotide T1 (cT1; Plant defensin)GIPCGESCVFIPCITAAIGCSCKSKVCYRNClitoria ternatea (Butterfly pea)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial21596752
DRAMP00798Cliotide T4 (cT4; Plant defensin)GIPCGESCVFIPCITGAIGCSCKSKVCYRNClitoria ternatea (Butterfly pea)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial21596752
DRAMP01064Anticancerous peptide 1 (Cr-ACP1; Plants)AWKLFDDGVCycas revoluta (Sago palm)Anticancer, Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial21882228
DRAMP01746Temporin-L (Temporin-1Tl; temporin-Tl; TL; Frogs, amphibians, animals)FVQWFSKFLGRILRana temporaria (European common frog)Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic, Anticancer., Antimicrobial9022710
DRAMP01607Aurein-1.2 (Frogs, amphibians, animals)GLFDIIKKIAESFLitoria raniformis (Southern bell frog)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial10951191,15572363,15203252
DRAMP01608Aurein-2.1 (Frogs, amphibians, animals)GLLDIVKKVVGAFGSLLitoria aurea (Green; also golden bell frog); also Litoria raniformis (Southern bell frog)Antimicrobial, Anticancer, Anti-Gram+10951191,15203252
DRAMP01612Aurein-2.5 (Frogs, amphibians, animals)GLFDIVKKVVGAFGSLLitoria raniformis (Southern bell frog); also Litoria aurea (Green; also golden bell frog)Antibacterial, Anticancer, Anti-Gram+, Antimicrobial10951191,15203252
DRAMP01613Aurein-2.6 (Frogs, amphibians, animals)GLFDIAKKVIGVIGSLLitoria raniformis (Southern bell frog)Antibacterial, Anticancer, Anti-Gram+, Antimicrobial10951191,15203252
DRAMP01614Aurein-3.1 (Frogs, amphibians, animals)GLFDIVKKIAGHIAGSILitoria raniformis (Southern bell frog); also Litoria aurea (Green; also golden bell frog)Antibacterial, Anticancer, Anti-Gram+, Antimicrobial10951191,15203252
DRAMP01617Aurein-3.2 (Frogs, amphibians, animals)GLFDIVKKIAGHIASSILitoria aurea (green; also golden bell frog); also Litoria raniformis (blue-thighed treefrog)Antibacterial, Anticancer, Anti-Gram+, Antimicrobial10951191,15203252
DRAMP01618Aurein-3.3 (Frogs, amphibians, animals)GLFDIVKKIAGHIVSSILitoria raniformis (blue-thighed treefrog)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial10951191,15203252
DRAMP01620Aurein-5.2 (Frogs, amphibians, animals)GLMSSIGKALGGLIVDVLKPKTPASLitoria raniformis (blue-thighed treefrog); also Litoria aurea (Green; also golden bell frog)Antibacterial, Anticancer, Anti-Gram+, Antimicrobial10951191,15203252
DRAMP02397Big defensin (RPD-1)AVPDVAFNAYGVenerupis philippinarum (Japanese carpet shell) (Tapes japonica)Anticancer, Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial14673509
DRAMP02926Tachyplesin I (Tac; TP1; Horseshoe Crab, arachnids, Chelicerata, arthropods, invertebrates, animals)KWCFRVCYRGICYRRCRTachypleus tridentatus (Japanese horseshoe crab)Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Anti-HIV, Anticancer, Antimicrobial12369825,2229025
DRAMP03571Antibacterial protein LL-37 (one chain of hCAP-18; Human, mammals, animals)LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESHomo sapiens (Human)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial16637646,18818205
DRAMP03573LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals)IGKEFKRIVQRIKDFLRNLVPRTESHomo sapiens (Human)Antibacterial, Anticancer, Anti-Gram-, Antimicrobial16637646
DRAMP03574LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals)FKRIVQRIKDFLRNLVHomo sapiens (Human)Antibacterial, Anticancer, Anti-Gram-, Antimicrobial16637646
DRAMP03687TsAP-1 (T. serrulatus antimicrobial peptide 1; scorpions, arachnids, invertebrates, animals)FLSLIPSLVGGSISAFKTityus serrulatus (Brazilian yellow scorpion)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial23770440
DRAMP03688TsAP-2 (T. serrulatus antimicrobial peptide 2; scorpions, arachnids, invertebrates, animals)FLGMIPGLIGGLISAFKTityus serrulatus (Brazilian yellow scorpion)Antibacterial, Antifungal, Anticancer, Anti-Gram+, Antimicrobial23770440
DRAMP03575LL-37(17-29) (C-terminal fragment of LL-37, LL; Human, mammals, animals)FKRIVQRIKDFLRHomo sapiensAntibacterial, Anti-Gram+, Anti-Gram-, Anticancer, Antimicrobial16637646,28178190
Disclaimer:
The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk.
Close
Sign in     login

Forgot your password?