Result: 1 - 20 of 277
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00795Cliotide T1 (cT1; Plant defensin)GIPCGESCVFIPCITAAIGCSCKSKVCYRNClitoria ternatea (Butterfly pea)Antibacterial, Anticancer21596752
DRAMP00798Cliotide T4 (cT4; Plant defensin)GIPCGESCVFIPCITGAIGCSCKSKVCYRNClitoria ternatea (Butterfly pea)Antibacterial, Anticancer21596752
DRAMP01064Anticancerous peptide 1 (Cr-ACP1; Plants)AWKLFDDGVCycas revoluta (Sago palm)Anticancer, Antibacterial21882228
DRAMP01607Aurein-1.2 (Frogs, amphibians, animals)GLFDIIKKIAESFLitoria raniformis (Southern bell frog)Antibacterial, Anticancer10951191,15572363,15203252
DRAMP01612Aurein-2.5 (Frogs, amphibians, animals)GLFDIVKKVVGAFGSLLitoria raniformis (Southern bell frog); also Litoria aurea (Green; also golden bell frog)Antibacterial, Anticancer10951191,15203252
DRAMP01613Aurein-2.6 (Frogs, amphibians, animals)GLFDIAKKVIGVIGSLLitoria raniformis (Southern bell frog)Antibacterial, Anticancer10951191,15203252
DRAMP01614Aurein-3.1 (Frogs, amphibians, animals)GLFDIVKKIAGHIAGSILitoria raniformis (Southern bell frog); also Litoria aurea (Green; also golden bell frog)Antibacterial, Anticancer10951191,15203252
DRAMP01617Aurein-3.2 (Frogs, amphibians, animals)GLFDIVKKIAGHIASSILitoria aurea (green; also golden bell frog); also Litoria raniformis (blue-thighed treefrog)Antibacterial, Anticancer10951191,15203252
DRAMP01618Aurein-3.3 (Frogs, amphibians, animals)GLFDIVKKIAGHIVSSILitoria raniformis (blue-thighed treefrog)Antibacterial, Anticancer10951191,15203252
DRAMP02397Big defensin (RPD-1)AVPDVAFNAYGVenerupis philippinarum (Japanese carpet shell) (Tapes japonica)Anticancer, Antibacterial14673509
DRAMP03571Antibacterial protein LL-37 (one chain of hCAP-18; Human, mammals, animals)LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESHomo sapiens (Human)Antibacterial, Anticancer16637646,18818205
DRAMP03573LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals)IGKEFKRIVQRIKDFLRNLVPRTESHomo sapiens (Human)Antibacterial, Anticancer16637646
DRAMP03574LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals)FKRIVQRIKDFLRNLVHomo sapiens (Human)Antibacterial, Anticancer16637646
DRAMP03575LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals)FKRIVQRIKDFLRHomo sapiens (Human)Antibacterial, Anticancer16637646
DRAMP03687TsAP-1 (T. serrulatus antimicrobial peptide 1; scorpions, arachnids, invertebrates, animals)FLSLIPSLVGGSISAFKTityus serrulatus (Brazilian yellow scorpion)Antibacterial, Anticancer23770440
DRAMP03688TsAP-2 (T. serrulatus antimicrobial peptide 2; scorpions, arachnids, invertebrates, animals)FLGMIPGLIGGLISAFKTityus serrulatus (Brazilian yellow scorpion)Antibacterial, Antifungal, Anticancer23770440
DRAMP03829GLK-19GLKKLLGKLLKKLGKLLLKSynthetic constructAntibacterial, Anticancer18957441
DRAMP00240Pep27 (Bacteriocin)MRKEFHNVLSSGQLLADKRPARDYNRKStreptococcus pneumoniae (Gram-negative bacteria)Antibacterial, Anticancer16004618
DRAMP00301Malanin chain A (Plant defensin)DYPKLTFTTSMalania oleiferaAnticancer, Cytotoxic19341757
DRAMP00302Malanin chain B (Plant defensin)DETXTDEEFNMalania oleiferaAnticancer, Cytotoxic19341757
Sign in     login

Forgot your password?