Result: 1 - 20 of 327
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00795Cliotide T1 (cT1; Plant defensin)GIPCGESCVFIPCITAAIGCSCKSKVCYRNClitoria ternatea (Butterfly pea)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial21596752
DRAMP00798Cliotide T4 (cT4; Plant defensin)GIPCGESCVFIPCITGAIGCSCKSKVCYRNClitoria ternatea (Butterfly pea)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial21596752
DRAMP01064Anticancerous peptide 1 (Cr-ACP1; Plants)AWKLFDDGVCycas revoluta (Sago palm)Anticancer, Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial21882228
DRAMP01746Temporin-L (Temporin-1Tl; temporin-Tl; TL; Frogs, amphibians, animals)FVQWFSKFLGRILRana temporaria (European common frog)Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic, Anticancer., Antimicrobial9022710
DRAMP01607Aurein-1.2 (Frogs, amphibians, animals)GLFDIIKKIAESFLitoria raniformis (Southern bell frog)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial10951191,15572363,15203252
DRAMP01608Aurein-2.1 (Frogs, amphibians, animals)GLLDIVKKVVGAFGSLLitoria aurea (Green; also golden bell frog); also Litoria raniformis (Southern bell frog)Antimicrobial, Anticancer, Anti-Gram+10951191,15203252
DRAMP01612Aurein-2.5 (Frogs, amphibians, animals)GLFDIVKKVVGAFGSLLitoria raniformis (Southern bell frog); also Litoria aurea (Green; also golden bell frog)Antibacterial, Anticancer, Anti-Gram+, Antimicrobial10951191,15203252
DRAMP01613Aurein-2.6 (Frogs, amphibians, animals)GLFDIAKKVIGVIGSLLitoria raniformis (Southern bell frog)Antibacterial, Anticancer, Anti-Gram+, Antimicrobial10951191,15203252
DRAMP01614Aurein-3.1 (Frogs, amphibians, animals)GLFDIVKKIAGHIAGSILitoria raniformis (Southern bell frog); also Litoria aurea (Green; also golden bell frog)Antibacterial, Anticancer, Anti-Gram+, Antimicrobial10951191,15203252
DRAMP01617Aurein-3.2 (Frogs, amphibians, animals)GLFDIVKKIAGHIASSILitoria aurea (green; also golden bell frog); also Litoria raniformis (blue-thighed treefrog)Antibacterial, Anticancer, Anti-Gram+, Antimicrobial10951191,15203252
DRAMP01618Aurein-3.3 (Frogs, amphibians, animals)GLFDIVKKIAGHIVSSILitoria raniformis (blue-thighed treefrog)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial10951191,15203252
DRAMP01620Aurein-5.2 (Frogs, amphibians, animals)GLMSSIGKALGGLIVDVLKPKTPASLitoria raniformis (blue-thighed treefrog); also Litoria aurea (Green; also golden bell frog)Antibacterial, Anticancer, Anti-Gram+, Antimicrobial10951191,15203252
DRAMP02397Big defensin (RPD-1)AVPDVAFNAYGVenerupis philippinarum (Japanese carpet shell) (Tapes japonica)Anticancer, Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial14673509
DRAMP02926Tachyplesin I (Tac; TP1; Horseshoe Crab, arachnids, Chelicerata, arthropods, invertebrates, animals)KWCFRVCYRGICYRRCRTachypleus tridentatus (Japanese horseshoe crab)Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Anti-HIV, Anticancer, Antimicrobial12369825,2229025
DRAMP03571Antibacterial protein LL-37 (one chain of hCAP-18; Human, mammals, animals)LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESHomo sapiens (Human)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial16637646,18818205
DRAMP03573LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals)IGKEFKRIVQRIKDFLRNLVPRTESHomo sapiens (Human)Antibacterial, Anticancer, Anti-Gram-, Antimicrobial16637646
DRAMP03574LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals)FKRIVQRIKDFLRNLVHomo sapiens (Human)Antibacterial, Anticancer, Anti-Gram-, Antimicrobial16637646
DRAMP03687TsAP-1 (T. serrulatus antimicrobial peptide 1; scorpions, arachnids, invertebrates, animals)FLSLIPSLVGGSISAFKTityus serrulatus (Brazilian yellow scorpion)Antibacterial, Anticancer, Anti-Gram+, Anti-Gram-, Antimicrobial23770440
DRAMP03688TsAP-2 (T. serrulatus antimicrobial peptide 2; scorpions, arachnids, invertebrates, animals)FLGMIPGLIGGLISAFKTityus serrulatus (Brazilian yellow scorpion)Antibacterial, Antifungal, Anticancer, Anti-Gram+, Antimicrobial23770440
DRAMP03575LL-37(17-29) (C-terminal fragment of LL-37, LL; Human, mammals, animals)FKRIVQRIKDFLRHomo sapiensAntibacterial, Anti-Gram+, Anti-Gram-, Anticancer, Antimicrobial16637646,28178190
Sign in     login

Forgot your password?