Result: 81 - 100 of 3859
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP01556Caerin-1.6 (Frogs, amphibians, animals)GLFSVLGAVAKHVLPHVVPVIAEKLLitoria xanthomera (Orange-thighed frog) (Litoria chloris)Antimicrobial, Antibacterial,Antiviral26026377,9230483,9204574,9516047
DRAMP01557Caerin-1.7 (Frogs, amphibians, animals)GLFKVLGSVAKHLLPHVAPVIAEKLLitoria xanthomera (Orange-thighed frog) (Litoria chloris)Antimicrobial, Antibacterial,Antiviral26026377,9230483,9204574,9516047
DRAMP01559Caerin-1.8 (Frogs, amphibians, animals)GLFKVLGSVAKHLLPHVVPVIAEKLLitoria chloris (Blue-thighed frog)Antimicrobial, Antibacterial, Antifungal, Antiviral9516047
DRAMP01629Phylloxin-S1 (Frogs, amphibians, animals; Predicted)GWMSKIASGIGTFLSGVQQGPhyllomedusa sauvagii (Waxy Monkey Leaf Frog)Antimicrobial, Antibacterial, Antifungal, Antiviral18644413
DRAMP01630Dermaseptin-LI1 (Frogs, amphibians, animals; Predicted)AVWKDFLKNIGKAAGKAVLNSVTDMVNEPhyllomedusa hypochondrialis (Orange legged leaf frog)Antimicrobial, Antibacterial, Antifungal, Antiviral18644413
DRAMP01631Dermaseptin-S7 (Frogs, amphibians, animals; Predicted)GLWKSLLKNVGKAAGKAALNAVTDMVNQPhyllomedusa sauvagei (Sauvage's leaf frog)Antimicrobial, Antibacterial, Antifungal, Antiviral14599725
DRAMP01632Dermaseptin-S8 (Frogs, amphibians, animals; Predicted)ALWKTMLKKLGTVALHAGKAALGAAADTISQPhyllomedusa sauvagei (Sauvage's leaf frog)Antimicrobial, Antibacterial, Antifungal, Antiviral14599725
DRAMP01654Dermaseptin-B8 (Frogs, amphibians, animals; Predicted)GLWSKIKEAGKAVLTAAGKAALGAVSDAVPhyllomedusa bicolor (Two-colored leaf frog)Antimicrobial, Antibacterial, Antifungal, Antiviral9305726
DRAMP01671Dermaseptin-4 (DS IV; Dermaseptin-S4, DS4; Frogs, amphibians, animals)ALWMTLLKKVLKAAAKALNAVLVGANAPhyllomedusa sauvagei (Sauvage's leaf frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral8306981,11850249,9395500
DRAMP01713OGA1 antimicrobial peptide (Frogs, amphibians, animals)VHLEEILLLLFFLGTISLSLCEEERDADEEENEVSGYAANVNVKRCGYKHGRANCGRGOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, AntiviralPubMed ID is not available
DRAMP01714OGF2 antimicrobial peptide (Frogs, amphibians, animals)MFTMKKSLLLLFFLGTINLSFCQEETNAEEERRDEEVAKMEEIKRGLLSGPRCGEESTMWTOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, AntiviralPubMed ID is not available
DRAMP01715OGG1 antimicrobial peptide (Frogs, amphibians, animals)MFTLKKPLLLLFFLGTINLSLCQDETNAEEERRDEEVVKMEEIKRGLLSGILGAGKHIVCGLTGCAKAOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, AntiviralPubMed ID is not available
DRAMP01716OGF1 antimicrobial peptide (Frogs, amphibians, animals)MFTLKKSLLLLFFLGTINLSLCQDVTNAEEERRDEEVAKMEEIKRGLLRPPRCGEAYSMWTOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, AntiviralPubMed ID is not available
DRAMP18350Siamycin II(Bacteriocin)CLGIGSCNDFAGCGYAIVCFWStreptomyces strains AA3891Antiviral, Anti-HIV, Antimicrobial7787424
DRAMP18349Siamycin I (Bacteriocin)CLGVGSCNDFAGCGYAVVCFWStreptomyces strain AA6532Antiviral, Anti-HIV, Antimicrobial8557614
DRAMP18347Siamycin(Bacteriocin)CLGVGSCNDFAGCGYAIVCFWStreptomyces sp. No. 73264Antiviral, Anti-HIV, Antimicrobial8619594
DRAMP18344Tricyclic peptide RP 71955 (Bacteriocin)CLGIGSCNNFAGCGYAVVCFWStreptomyces sp. (strain SP9440)Antiviral, Anti-HIV, Antimicrobial8270499
DRAMP18345Tricyclic peptide RP 71955 (Bacteriocin)CLGIGSCNNFAGCGYAVVCFWStreptomyces sp. (strain SP9440)Antiviral, Anti-HIV, Antimicrobial8270499
DRAMP01985Brevinin-2HS1 (Frogs, amphibians, animals)GLWDTIKQAGKKIFLSVLDKIRCKVAGGCHuia schmackeri (Chinese piebald odorous frog)Antimicrobial, Antibacterial, Antifungal, Antiviral18423796
DRAMP01111Maximin-5 (Toads, amphibians, animals)SIGAKILGGVKTFFKGALKELASTYLQBombina maxima (Giant fire-bellied toad) (Chinese red belly toad)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral, Anti-cancer15770703,11835991
Close
Sign in     login

Forgot your password?