Result: 61 - 80 of 3859
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00875Leaf cyclotide 1 (Vhl-1; Plant defensin)SISCGESCAMISFCFTEVIGCSCKNKVCYLNViola hederacea (Australian violet)Antimicrobial, Antiviral18008336,15824119
DRAMP00876Leaf cyclotide 2 (Vhl-2; Plant defensin)GLPVCGETCFTGTCYTNGCTCDPWPVCTRNViola hederacea (Australian violet)Antimicrobial, Antiviral15824119,PubMed ID is not available
DRAMP00879Circulin-C (CIRC; Plant defensin)GIPCGESCVFIPCITSVAGCSCKSKVCYRNChassalia parviflora Antimicrobial, Antiviral10691702,18008336
DRAMP00880Circulin-D (CIRD; Plant defensin)KIPCGESCVWIPCVTSIFNCKCKENKVCYHDChassalia parviflora Antimicrobial, Antiviral10691702,18008336
DRAMP00881Circulin-E (CIRE; Plant defensin)KIPCGESCVWIPCLTSVFNCKCENKVCYHDChassalia parviflora Antimicrobial, Antiviral10691702,18008336
DRAMP00882Circulin-F (CIRF; Plant defensin)KVCYRAIPCGESCVWIPCISAAIGCSCKNChassalia parvifloraAntimicrobial, Antiviral10691702,18008336
DRAMP00936Ribosome-inactivating protein TAP-29 (rRNA N-glycosidase; Plant defensin)DVSFRLSGATSKKKVYFISNLRKALPNEKKLYDIPLVRSSXSGSKTrichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)Antiviral, Cytotoxic, Antimicrobial1713684
DRAMP00952Viscotoxin A1 (Plant defensin)KSCCPNTTGRNIYNTCRLTGSSRETCAKLSGCKIISASTCPSNYPKViscum album (European mistletoe)Antimicrobial, Antibacterial, Antifungal, Antiviral18703848
DRAMP01000Ascalin (Plants)YQCGQGG Allium cepa var. aggregatum (shallot)Antimicrobial, Antifungal, Antiviral12126728
DRAMP01003Gymnin (Plants)KTCENLADDYGymnocladus chinensis Antimicrobial, Antifungal, Antiviral14499273
DRAMP01005Cicerarin (Plant defensin)VKSTGRADDDLAVKTKYLPPCicer arietinum (chickpea)Antimicrobial, Antifungal, Antiviral12895650
DRAMP01010Lunatusin (Plants)KTCENLADTFRGPCFATSNCPhaseolus lunatus L.(Chinese lima bean)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal16269344
DRAMP01067Coccinin (Plant defensin)KQTENLADTYPhaseolus coccineus (Scarlet runner bean) (Phaseolus multiflorus)Antimicrobial, Antifungal, Antiviral15572193
DRAMP01084Alyteserin-2b (toads, amphibians, animals; Predicted)ILGAILPLVSGLLSNKLAlytes obstetricans (European midwife toad)Antimicrobial, Antibacterial, Antifungal, Antiviral19463738
DRAMP01086Alyteserin-2c (toads, amphibians, animals; Predicted)ILGAILPLVSGLLSSKLAlytes obstetricans (European midwife toad)Antimicrobial, Antibacterial, Antifungal, Antiviral19463738
DRAMP01087Alyteserin-1d (toads, amphibians, animals; Predicted)GLKDIFKAGLGSLVKNIAAHVANAlytes obstetricans (European midwife toad)Antimicrobial, Antibacterial, Antifungal, Antiviral19463738
DRAMP01161Uperin-7.1 (Frogs, amphibians, animals)GWFDVVKHIASAVLitoria ewingi (Brown tree frog) (Ewing's tree frog)Antimicrobial, Antibacterial, Anti-Gram+, AntiviralPubMed ID is not available
DRAMP01225Palustrin-3AR (Frogs, amphibians, animals)GIFPKIIGKGIVNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDECRana areolata (North American crawfish frog)Antimicrobial, Antibacterial, Antiviral12429503
DRAMP01366Maculatin-1.3 (frog, amphibia, animals)GLLGLLGSVVSHVVPAIVGHFLitoria eucnemis (Australian anurans)Antimicrobial, Antibacterial, Antiviral15203252
DRAMP01551Caerin-1.2 (Frogs, amphibians, animals)GLLGVLGSVAKHVLPHVVPVIAEHLLitoria caerulea (Australian frog)Antimicrobial, Antibacterial,Antiviral26026377,PubMed ID is not available
Close
Sign in     login

Forgot your password?