| If you want edit the query,Please OndoubleCick... | |||||
|---|---|---|---|---|---|
| DRAMP: | Structure | Cell Toxicity | |||
| Sequence: | Structure Method | GET-translational Modification: | |||
| Source: | TarGET Organism | ||||
| Peptide Name: | Binding TarGET | ||||
| Gene Name: | |||||
| Sequence Length: | Hide Query | ||||
| RDAMP ID | Peptide Name | Source | Sequence | Activity | Pubmed ID | |
|---|---|---|---|---|---|---|
| DRAMP01316 | Phylloseptin 14 (PS-14; Frogs, amphibians, animals) | Phyllomedusa azurea (Orange-legged monkey frog) (Phyllomedusa hypochondrialis azurea) | FLSLIPAAISAVSALADHF | Antimicrobial | 17553595 | |
| DRAMP01317 | Phylloseptin 15 (PS-15; Frogs, amphibians, animals) | Phyllomedusa azurea (Orange-legged monkey frog) (Phyllomedusa hypochondrialis azurea) | LLSLVPHAINAVSAIAKHF | Antimicrobial | 17553595 | |
| DRAMP01318 | Antimicrobial peptide 1 (Frogs, amphibians, animals) | Phyllomedusa hypochondrialis (Orange-legged leaf frog) | LRPAVIVRTKAL | Antimicrobial, Antibacterial, Anti-Gram+ | PubMed ID is not available | |
| DRAMP01321 | Amolopin-n1 antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTLKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKRFFPIVGKLLSG | Antimicrobial | 19843479 | |
| DRAMP01322 | Amolopin-n2 antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | FTMKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKR | Antimicrobial | PubMed ID is not available | |
| DRAMP01323 | Amolopin-2e antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTMKKSLLLLFFLGTIHLSLCEQERNAEEERRDDLGERQAEVEKRFLPIAGKLLSGLSGLLGK | Antimicrobial | 19843479 | |
| DRAMP01324 | Amolopin-2f antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTLKKSLLLLFFLGTINLSLCEQERNAEEERRDEPDERNAEVEKRFFPIVGKLLFGLSGLLGK | Antimicrobial | 19843479 | |
| DRAMP01325 | Amolopin-2g antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTLKKSLLLLFFLGTINLSLCEQERNAEEERRDEPDERNAEVEKRFFPIVGKLLSGLSGLLGK | Antimicrobial | 19843479 | |
| DRAMP01326 | Amolopin-2h antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTLKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKRFFPIVGKLLFGLFGLLGK | Antimicrobial | 19843479 | |
| DRAMP01327 | Amolopin-2i antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFPLKKSLLLLFFLATINLSLCEQERNAEEERRDEPDERNAEVEKRFFPIVGKLLSGLLGK | Antimicrobial | 19843479 | |
| DRAMP01328 | Amolopin-2k antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTLKKSLLLLFFLATINLSFCEQERNAEEERRDEPDERNAEVEKRFFPIVGKLLFGLLGK | Antimicrobial | PubMed ID is not available | |
| DRAMP01329 | Amolopin-5a antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTMKKSLLLLFFLGAISLSLCEQERDADEEETEGGAKVETVKRASVPPGFTPFRVAPEIV | Antimicrobial | PubMed ID is not available | |
| DRAMP01330 | Amolopin-6a antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTMKKSLLLLFFLGMISLSLCKQERDANEERRDDPDENEENGGEAKVEEIKRAARPPLGCKAAFC | Antimicrobial | PubMed ID is not available | |
| DRAMP01331 | Amolopin-6b antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTMKKSLLLLFFLGMISLSLCKQERDANEERRDDPDENEENGGEAKVEEIKRAARPPLRCKAAFC | Antimicrobial | PubMed ID is not available | |
| DRAMP01332 | Amolopin-7a antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTMKKSLLLLFFLGAISLSLCEQERDADEEDGGEVTEEEVKRAAFRGCWTKNYSPKPCLGKR | Antimicrobial | PubMed ID is not available | |
| DRAMP01333 | Amolopin-8a antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTMKKSLLLLFFLGMISLSLCKQERDANEERRDDPDENEENGGEAKVEEIQRGARPPLRCKAALC | Antimicrobial | PubMed ID is not available | |
| DRAMP01334 | Amolopin-9a antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTLKKSMLLLFFLGTISLSLCEEERNADEDDGEKEVKRGIFALIKTAAKFVGKNLLKQAGKAGLEHLACKANNQC | Antimicrobial | 19843479 | |
| DRAMP01335 | Amolopin-9b antimicrobial peptide (Frogs, amphibians, animals) | Amolops loloensis (Rufous-spotted torrent frog) | MFTMKKSLLLLFFLGTISLSLCEEERSADEDDGEKGVKRGIFSLIKTAAKFVGKNLLKQAGKAGVEHLACKANNQC | Antimicrobial | 19843479 | |
| DRAMP01336 | Amolopin-p1 | Amolops loloensis (Rufous-spotted torrent frog) | NILSSIVNGINRALSFFG | Antimicrobial | Pubmed ID is not available | |
| DRAMP01337 | Amolopin-p2 | Amolops loloensis (Rufous-spotted torrent frog) | NVLSSVANGINRALSFFG | Antimicrobial | Pubmed ID is not available |
The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk. DRAMP is consturcted by Zheng group.
This work is licensed under a Creative Commons Attribution 4.0 International License.
