Result: 21 - 40 of 1888
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP04528CrusEs (cDNA encoding crustin-like peptide)TCRYWCKTPENQTYCCEDEREIPSKVGLKPGKCPPVRPVCPPTRGFFEPPKTCSNDGSCYGADKCCFDRCLGEHVCKPIQTRGChinese mitten crab, Eriocheir sinensisAntibacterial, Antifungal, Antiviral, In20144896
DRAMP00060Bacteriocin cinnamycin (Lanthiopeptin Ro 09-0198)CRQSCSFGPFTFVCDGNTKStreptomyces cinnamoneus cinnamoneus DSM 40005 (Gram-positive bacteria)Antibacterial, Antiviral2125590,2544544,8882709
DRAMP00205Tricyclic peptide RP 71955 (Bacteriocin)CLGIGSCNDFAGCGYAVVCFWStreptomyces sp. (strain SP9440) (Gram-positive bacteria)Antiviral8270499,8286361
DRAMP00245Gramicidin A (GA; Nonribosomally synthesized bacteriocin)VGALAVVVWLWLWLWBacillus brevis (soil bacterium) (Gram-positive bacteria)Antibacterial, Antiviral19870884,8810522
DRAMP00246Gramicidin B (GB; Bacteriocin)VGALAVVVWLFLWLWBacillus brevis (soil bacterium) (Gram-positive bacteria)Antibacterial, Antiviral11570868
DRAMP00247Gramicidin C (GC; Bacteriocin)VGALAVVVWLYLWLWBacillus brevis (soil bacterium) (Gram-positive bacteria)Antibacterial, Antiviral11570868
DRAMP00261Antiviral lectin scytovirin (SVN)GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAAScytonema varium (cyanobacterium)Antiviral12614152,16647158,17965185
DRAMP00262Cyanovirin-N (CV-N)LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYENostoc ellipsosporum (cyanobacterium)Antiviral9210678,9665171
DRAMP00264Coconut antifungal peptide (Plants)EQCREEEDDRCocos nuciferaAntifungal, Antiviral16308082
DRAMP00272Thaumatin-like protein (Plants)AKITFTNNHPRTIWPCastanopsis chinensis (Chinese chinquapin) (Kweilin chestnut)Antifungal, Antiviral12565869
DRAMP00279Plastocyanin (Plants)AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETVVRKLSTPGVYGVYCEPHAGAGMKMTITVQUlva pertusa (Sea lettuce)Antiviral9933621,PubMed ID is not availbale
DRAMP00299Ribonuclease (Plants)DADIAVWAPPVNAQNThelephora ganbajun (Mushroom)Antiviral15474506
DRAMP00333Antiviral protein DAP-32 (Ribosome-inactivating protein; Plant defensin)AVKTITLNLVSPSANRYATFLTEIRDNVRXRSLDYSHSGIDVIGAPSSRDSXLNINFQSPDianthus caryophyllus (Carnation) (Clove pink)Antiviral1936243
DRAMP00334Antiviral protein GAP-31 (Ribosome-inactivating protein; Plant defensin)GLDTVSFSTKGATYITYVNFLNELRVKTKPEGNSHGIPSLRKSSDDPGSSFVVAGSuregada multiflora (False lime) (Gelonium multiflorum)Antiviral1936243
DRAMP00339Alpha-basrubrin (Fragment; Plants)GADFQECMKEHSQKQHQHQGBasella alba (Malabar spinach) (Basella rubra)Antifungal, Antiviral11688973
DRAMP00340Beta-basrubin (Plants)KIMAKPSKFYEQLRGRBasella alba (Malabar spinach) (Basella rubra)Antifungal, Antiviral11688973
DRAMP00341Antifungal protein ginkbilobin-1 (Ginkbilobin, GNL; Plants)ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAGGinkgo biloba (Ginkgo) (Maidenhair tree)Antibacterial, Antifungal, Antiviral11118300
DRAMP00361Non-specific lipid-transfer protein (LTP; Harmalin; Plants)ITCPQVTQSLAPCVPYLISGPeganum harmala (Syrian rue) (Harmal peganum)Antifungal, Antiviral, AnticancerPubMed ID is not available
DRAMP00409Defensin-like protein (Sesquin; Plant defensin)KTCENLADTYVigna unguiculata subsp. sesquipedalis (Yard-Long bean) Antibacterial, Antifungal, Antiviral15949629
DRAMP00427Defensin-like protein AX1 (Antifungal protein AX1; Plant defensin)AICKKPSKFFKGACGRDADCEKACDQENWPGGVCVPFLRCECQRSCBeta vulgaris (Sugar beet)Antibacterial, Antifungal, Antiviral7655063
Close
Sign in     login

Forgot your password?