| DRAMP ID | Peptide NAME | Peptide Sequence | Source | Biological Activity | Pubmed ID | |
|---|---|---|---|---|---|---|
| DRAMP20766 | Pore-forming peptide ameobapore A(Amoeba peptide, AP-A; Parasite, amoebozoa, protozoa, protists) | GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC | Entamoeba histolytica | Antimicrobial, Antibacterial, Anti-Gram+, Antibiotic | 1881907,7715451,11948186 | |
| DRAMP20767 | Pore-forming peptide ameobapore B (Parasite, amoebozoa, protozoa, protists) | GAILCNLCKDTVKLVENLLTVDGAQAVRQYIDNLCGKASGFLGTLCEKILSFGVDELVKLIENHVDPVVVCEKIHAC | Entamoeba histolytica | Antimicrobial, Antibacterial, Anti-Gram+, Antibiotic | 7715451 | |
| DRAMP20768 | Pore-forming peptide ameobapore C (EH-APP; Parasite, amoebozoa, protozoa, protists) | IPVLCPVCTSLVGKLIDLVLGGAVDKVTDYLETLCAKADGLVETLCTKIVSYGIDKLIEKILEGGSAKLICGLIHAC | Entamoeba histolytica | Antimicrobial, Antibacterial, Anti-Gram+, Antibiotic | 7715451 | |
| DRAMP20769 | Naegleriapore A (NP-A; parasite, amoebozoa; protozoa, protists) | DAECEICKFVIQQVEAFIESNHSQAEIQKELNKLCSSVPSIFTQTCLSIARMVPYIIKKLEEHNSPGQVCQGLHLCKSS | Naegleria fowleri (Brain eating amoeba) | Antimicrobial, Antibacterial, Anti-Gram+ | 11948186 | |
| DRAMP20770 | Naegleriapore B (NP-B; parasite, amoebozoa, protozoa, protists) | SVIGCEICEWLVATAEGFVNKTKPQIEQELLQICAKLGPYEQICDQLVLMELPDIIDQIIAKEPPAIVCSQVKICNGSAMAVAA | Naegleria fowleri (Brain eating amoeba) | Not found | 11948186 | |
| DRAMP20771 | Acanthaporin (parasite, amoebozoa, protozoa, protists) | GKCSVLKKVACAAAIAGAVAACGGIDLPCVLAALKAAEGCASCFCEDHCHGVCKDLHLC | Acanthamoeba culbertsoni | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- | 23143413 | |
| DRAMP20772 | cPcAMP1/26 (ciliate, Protists) | PPHKKKLAVYPVFLFYLFLSWFSLIV | Paramecium caudatum | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- | 26883426 |
The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk. DRAMP is consturcted by Zheng group.
This work is licensed under a Creative Commons Attribution 4.0 International License.
