Result: 1 - 20 of 2960
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00275Snakin-1 (StSN1; Cys-rich; Plant defensin)GSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCPSolanum tuberosum (potato)Antibacterial, Antifungal11891250,9885189
DRAMP00384Cc-GRP (Gly-rich; Plants)GNEGGGHGGHGGYGGYHHHGGGGGGYGGYHGGGGSCoffea canephoraAntifungal23500079
DRAMP00416Raphanus sativus Antifungal Protein 3 (Rs-AFP3; Plant defensin)KLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPCRaphanus sativus (Radish) & Brassica napus (Rape)Antifungal7780308,8422949
DRAMP00417Raphanus sativus Antifungal Protein 4 (Rs-AFP4; Plant defensin)QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPCRaphanus sativus (Radish)Antifungal7780308
DRAMP00422Defensin-like protein 1 (Sa-AFP1; Plant defensin)QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPCSinapis alba (White mustard) (Brassica hirta)Antifungal8422949,8836771
DRAMP00423Defensin-like protein 2 (Sa-AFP2; Plant defensin)KLCQRPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPCSinapis alba (White mustard) (Brassica hirta)Antifungal8422949
DRAMP00425Tn-AFP1 (Trapa natans antifungal peptide; Plant defensin)LMCTHPLDCSNTrapa natansAntifungal21736910
DRAMP00436Pisum sativum defensin 1 (Psd1; Plant defensin)KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNCPisum sativum (Garden pea)Antifungal10860545,11697857,11812144
DRAMP00437Pisum sativum defensin 2 (Psd2; Plant defensin)KTCENLSGTFKGPCIPDGNCNKHCRNNEHLLSGRCRDDFRCWCTNRCPisum sativum (Garden pea)Antifungal10860545
DRAMP00450Defensin-like protein 2A (AFP2A; M2A; Plant defensin)QKLCQRPSGTWSGVCGNNNACRNQCINLEKARHGSCNYVFPAHKCICYFPCSinapis alba (White mustard) (Brassica hirta)Antifungal8422949,8836771
DRAMP00454Petunia hybrida defensin 1 (PhD1; Cys-rich; Plant defensin)ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKECPetunia hybrida (Petunia)Antifungal12644678#12846570
DRAMP00764Piceain 1 (Plants)KSLRPRCWIKIKFRCKSLKFPicea sitchensisAntibacterial, Antifungal21644248
DRAMP00765Piceain 2 (Plants)RPRCWIKIKFRCKSLKFPicea sitchensisAntibacterial, Antifungal21644248
DRAMP00856Kalata-B1 (Plant defensin)GLPVCGETCVGGTCNTPGCTCSWPVCTRNOldenlandia affinis Antibacterial, Antifungal, Insecticidal10430870,7703226,17534989,12779323,23129773
DRAMP00877Circulin-A (CIRA; Plant defensin)GIPCGESCVWIPCISAALGCSCKNKVCYRNChassalia parviflora Antibacterial, Antifungal, Antiviral10430870,9878410
DRAMP00878Circulin-B (CIRB; Plant defensin)GVIPCGESCVFIPCISTLLGCSCKNKVCYRNChassalia parviflora Antibacterial, Antifungal, Antiviral10430870,
DRAMP00933Antimicrobial peptide 1 (AMP1; MiAMP1; Plant defensin)SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQCMacadamia integrifolia (Macadamia nut)Antibacterial, Antifungal9108242,10543955
DRAMP01004Cucurmoschin (Plants)PQRGEGGRAGNLLREEQEICucurbita maxima (winter squash)Antifungal14499274
DRAMP01016Antimicrobial peptide 1 (MJ-AMP1; Plant defensin)QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNRMirabilis jalapa (Garden four-o'clock)Antibacterial, Antifungal1733929,7647302
DRAMP01017Antimicrobial peptide 2 (MJ-AMP2; Plant defensin)CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNRMirabilis jalapa (Garden four-o'clock)Antibacterial, Antifungal1733929,7647302
Sign in     login

Forgot your password?