Result: 1 - 20 of 3336
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00275Snakin-1 (StSN1; Cys-rich; Plant defensin)GSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCPSolanum tuberosum (potato)Antibacterial, Antifungal, Anti-Gram+, Antimicrobial11891250,9885189
DRAMP00384Cc-GRP (Gly-rich; Plants)GNEGGGHGGHGGYGGYHHHGGGGGGYGGYHGGGGSCoffea canephoraAntifungal, Antimicrobial23500079
DRAMP00416Raphanus sativus Antifungal Protein 3 (Rs-AFP3; Plant defensin)KLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPCRaphanus sativus (Radish) & Brassica napus (Rape)Antifungal, Antimicrobial7780308,8422949
DRAMP00417Raphanus sativus Antifungal Protein 4 (Rs-AFP4; Plant defensin)QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPCRaphanus sativus (Radish)Antifungal, Antimicrobial7780308
DRAMP00422Defensin-like protein 1 (Sa-AFP1; Plant defensin)QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPCSinapis alba (White mustard) (Brassica hirta)Antifungal, Antimicrobial8422949,8836771
DRAMP00423Defensin-like protein 2 (Sa-AFP2; Plant defensin)KLCQRPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPCSinapis alba (White mustard) (Brassica hirta)Antifungal, Antimicrobial8422949
DRAMP00425Tn-AFP1 (Trapa natans antifungal peptide; Plant defensin)LMCTHPLDCSNTrapa natansAntifungal, Antimicrobial21736910
DRAMP00436Pisum sativum defensin 1 (Psd1; Plant defensin)KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNCPisum sativum (Garden pea)Antifungal, Antimicrobial10860545,11697857,11812144
DRAMP00437Pisum sativum defensin 2 (Psd2; Plant defensin)KTCENLSGTFKGPCIPDGNCNKHCRNNEHLLSGRCRDDFRCWCTNRCPisum sativum (Garden pea)Antifungal, Antimicrobial10860545
DRAMP00450Defensin-like protein 2A (AFP2A; M2A; Plant defensin)QKLCQRPSGTWSGVCGNNNACRNQCINLEKARHGSCNYVFPAHKCICYFPCSinapis alba (White mustard) (Brassica hirta)Antifungal, Antimicrobial8422949,8836771
DRAMP00454Petunia hybrida defensin 1 (PhD1; Cys-rich; Plant defensin)ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKECPetunia hybrida (Petunia)Antifungal, Antimicrobial12644678#12846570
DRAMP00764Piceain 1 (Plants)KSLRPRCWIKIKFRCKSLKFPicea sitchensisAntibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial21644248
DRAMP00765Piceain 2 (Plants)RPRCWIKIKFRCKSLKFPicea sitchensisAntibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial21644248
DRAMP00856Kalata-B1 (Plant defensin)GLPVCGETCVGGTCNTPGCTCSWPVCTRNOldenlandia affinis Antibacterial, Antifungal, Insecticidal, Anti-Gram+, Anti-Gram-, Antimicrobial10430870,7703226,17534989,12779323,23129773
DRAMP00877Circulin-A (CIRA; Plant defensin)GIPCGESCVWIPCISAALGCSCKNKVCYRNChassalia parviflora Antibacterial, Antifungal, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial10430870,9878410
DRAMP00878Circulin-B (CIRB; Plant defensin)GVIPCGESCVFIPCISTLLGCSCKNKVCYRNChassalia parviflora Antibacterial, Antifungal, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial10430870,
DRAMP00933Antimicrobial peptide 1 (AMP1; MiAMP1; Plant defensin)SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQCMacadamia integrifolia (Macadamia nut)Antibacterial, Antifungal, Antimicrobial9108242,10543955
DRAMP01004Cucurmoschin (Plants)PQRGEGGRAGNLLREEQEICucurbita maxima (winter squash)Antifungal, Antimicrobial14499274
DRAMP01016Antimicrobial peptide 1 (MJ-AMP1; Plant defensin)QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNRMirabilis jalapa (Garden four-o'clock)Antibacterial, Antifungal, Anti-Gram+, Antimicrobial1733929,7647302
DRAMP01017Antimicrobial peptide 2 (MJ-AMP2; Plant defensin)CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNRMirabilis jalapa (Garden four-o'clock)Antibacterial, Antifungal, Anti-Gram+, Antimicrobial1733929,7647302
The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk.
Sign in     login

Forgot your password?