Result: 1 - 20 of 246
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00856Kalata-B1 (Plant defensin)GLPVCGETCVGGTCNTPGCTCSWPVCTRNOldenlandia affinis Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Insecticidal10430870,7703226,17534989,12779323,23129773
DRAMP03217M-oxotoxin-Ot1a (Oxyopinin-1, Oxki1; spiders, Arthropods, animals)FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQOxyopes takobius (Lynx spider) (Oxyopes foliiformis)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Insecticidal11976325,15328050
DRAMP03222M-ctenitoxin-Cs1a (M-CNTX-Cs1a; Cupiennin-1a; spiders, Arthropods, animals)GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQMECupiennius salei (Wandering spider)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Insecticidal11792701,17319697
DRAMP03236M-zodatoxin-Lt8a (M-ZDTX-Lt8a; Cytoinsectotoxin-1a, CIT-1a; spiders, Arthropods, animals)GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKALQKASEKLLachesana tarabaevi (Spider)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Insecticidal18215128
DRAMP00322Insecticidal protein LA-a (Latex abundant protein a; Plant defensin)SEPQXGRDAGGALMorus alba (White mulberry)Insecticidal20109180
DRAMP00323Insecticidal protein LA-b (Latex abundant protein b; Plant defensin)SEQQXGRDVGGALMorus alba (White mulberry)Insecticidal20109180
DRAMP00804Cycloviolacin-O1 (Plant defensin)GIPCAESCVYIPCTVTALLGCSCSNRVCYNViola odorata (Sweet violet)Insecticidal 16872274,10600388,12482868
DRAMP00805Cycloviolacin-O2 (Plant defensin)GIPCGESCVWIPCISSAIGCSCKSKVCYRNViola biflora (Yellow wood violet) & Viola odorata (Sweet violet)Insecticidal 16872274,10600388
DRAMP00806Cycloviolacin-O3 (Plant defensin)GIPCGESCVWIPCLTSAIGCSCKSKVCYRNViola odorata (Sweet violet)Insecticidal 16872274,10600388
DRAMP00807Cycloviolacin-O4 (Plant defensin)GIPCGESCVWIPCISSAIGCSCKNKVCYRNViola odorata (Sweet violet)Insecticidal 16872274,10600388
DRAMP00808Cycloviolacin-O5 (Plant defensin)GTPCGESCVWIPCISSAVGCSCKNKVCYKNViola odorata (Sweet violet)Insecticidal 16872274,10600388
DRAMP00809Cycloviolacin-O6 (Plant defensin)GTLPCGESCVWIPCISAVGCSCKSKVCYKNViola odorata (Sweet violet)Insecticidal 16872274,10600388
DRAMP00810Cycloviolacin-O7 (Plant defensin)SIPCGESCVWIPCTITALAGCKCKSKVCYNViola odorata (Sweet violet)Insecticidal 16872274,10600388
DRAMP00811Cycloviolacin-O8 (Cyclotide c1; Plant defensin)GTLPCESCVWIPCISSVVGCSCKSKVCYKNViola odorata (Sweet violet)Insecticidal 16872274,10600388
DRAMP00812Cycloviolacin-O9 (Vbc5; Plant defensin)GIPCGESCVWIPCLTSAVGCSCKSKVCYRNViola odorata (Sweet violet) & Viola biflora (Yellow wood violet)Insecticidal 16872274,10600388,18191970
DRAMP00813Cycloviolacin-O10 (Plant defensin)GIPCGESCVYIPCLTSAVGCSCKSKVCYRNViola odorata (Sweet violet)Insecticidal 16872274,10600388
DRAMP00814Cycloviolacin-O11 (Cyclotide c2; Plant defensin)GTLPCGESCVWIPCISAVVGCSCKSKVCYKNViola odorata (Sweet violet)Insecticidal 16872274,10600388
DRAMP00816Cycloviolacin-O13 (Cyclotide c3; Plant defensin)GIPCGESCVWIPCISAAIGCSCKSKVCYRNViola odorata (Sweet violet)Insecticidal 16872274
DRAMP00817Cycloviolacin-O14 (Plant defensin)GSIPACGESCFKGKCYTPGCSCSKYPLCAKNViola odorata (Sweet violet)Insecticidal 16872274
DRAMP00818Cycloviolacin-O15 (Plant defensin)GLVPCGETCFTGKCYTPGCSCSYPICKKNViola odorata (Sweet violet)Insecticidal 16872274
Sign in     login

Forgot your password?