Result: 41 - 60 of 2013
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00800Cycloviolin-B (Plant defensin)GTACGESCYVLPCFTVGCTCTSSQCFKNLeonia cymosa (Sacha uba)Antiviral10813905
DRAMP00801Cycloviolin-C (Plant defensin)GIPCGESCVFIPCLTTVAGCSCKNKVCYRNLeonia cymosa (Sacha uba)Antiviral10813905
DRAMP00802Cycloviolin-D (Plant defensin)GFPCGESCVFIPCISAAIGCSCKNKVCYRNLeonia cymosa (Sacha uba)Antiviral10813905
DRAMP00803Palicourein (Cyclotides; Plants)GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRNPalicourea condensata (Cappel)Antiviral11430013,14725768
DRAMP00831Cycloviolacin-H3 (Plant defensin)GLPVCGETCFGGTCNTPGCICDPWPVCTRNViola hederacea (Australian violet)Antiviral10600388
DRAMP00832Cycloviolacin-H4 (Plant defensin)GIPCAESCVWIPCTVTALLGCSCSNNVCYNViola hederacea (Australian violet)Antiviral10600388
DRAMP00833Cycloviolacin-Y1 (Plants)GGTIFDCGETCFLGTCYTPGCSCGNYGFCYGTNViola yedoensis (Chinese herb)Antiviral18081258
DRAMP00834Cycloviolacin-Y2 (Plants)GGTIFDCGESCFLGTCYTAGCSCGNWGLCYGTNViola yedoensis (Chinese herb)Antiviral18081258
DRAMP00835Cycloviolacin-Y3 (Plants)GGTIFDCGETCFLGTCYTAGCSCGNWGLCYGTNViola yedoensis (Chinese herb)Antiviral18081258
DRAMP00836Cycloviolacin-Y4 (Plants)GVPCGESCVFIPCITGVIGCSCSSNVCYLNViola yedoensis (Chinese herb)Antiviral18081258
DRAMP00837Cycloviolacin-Y5 (Plants)GIPCAESCVWIPCTVTALVGCSCSDKVCYNViola yedoensis (Chinese herb)Antiviral18081258
DRAMP00863Kalata-B8 (Plant defensin)GSVLNCGETCLLGTCYTTGCTCNKYRVCTKDOldenlandia affinisAntiviral16207177,17534989
DRAMP00875Leaf cyclotide 1 (Vhl-1; Plant defensin)SISCGESCAMISFCFTEVIGCSCKNKVCYLNViola hederacea (Australian violet)Antiviral15824119
DRAMP00876Leaf cyclotide 2 (Vhl-2; Plant defensin)GLPVCGETCFTGTCYTNGCTCDPWPVCTRNViola hederacea (Australian violet)Antiviral15824119,PubMed ID is not available
DRAMP00879Circulin-C (CIRC; Plant defensin)GIPCGESCVFIPCITSVAGCSCKSKVCYRNChassalia parviflora Antiviral10691702
DRAMP00880Circulin-D (CIRD; Plant defensin)KIPCGESCVWIPCVTSIFNCKCKENKVCYHDChassalia parviflora Antiviral10691702
DRAMP00881Circulin-E (CIRE; Plant defensin)KIPCGESCVWIPCLTSVFNCKCENKVCYHDChassalia parviflora Antiviral10691702
DRAMP00882Circulin-F (CIRF; Plant defensin)KVCYRAIPCGESCVWIPCISAAIGCSCKNChassalia parvifloraAntiviral10691702
DRAMP00936Ribosome-inactivating protein TAP-29 (rRNA N-glycosidase; Plant defensin)DVSFRLSGATSKKKVYFISNLRKALPNEKKLYDIPLVRSSXSGSKTrichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)Antiviral, Cytotoxic1713684
DRAMP00952Viscotoxin A1 (Plant defensin)KSCCPNTTGRNIYNTCRLTGSSRETCAKLSGCKIISASTCPSNYPKViscum album (European mistletoe)Antibacterial, Antifungal, Antiviral, An18703848
Sign in     login

Forgot your password?