Result: 41 - 60 of 3859
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00428Defensin-like protein AX2 (Antifungal protein AX2; Cys-rich; Plant defensin)ATCRKPSMYFSGACFSDTNCQKACNREDWPNGKCLVGFKCECQRPCBeta vulgaris (Sugar beet)Antimicrobial, Antibacterial, Antifungal, Antiviral7655063
DRAMP00762Vaby D (Plant defensin)GLPVCGETCFGGTCNTPGCTCDPWPVCTRNViola abyssinica (Ethiopian highlands)Antimicrobial, Antibacterial, Antifungal, Antiviral21434649
DRAMP00763Vaby A (Plant defensin)GLPVCGETCAGGTCNTPGCSCSWPICTRNViola abyssinica (Ethiopian highlands)Antimicrobial, Antibacterial, Antifungal, Antiviral21434649
DRAMP00788Varv peptide E (Varv E; Plant defensin)GLPICGETCVGGTCNTPGCSCSWPVCTRNViola arvensis (European field pansy) (Field violet)Anti-cancer, Antiviral18008336,10075760,14987049,20580652
DRAMP00799Cycloviolin-A (Plant defensin)GVIPCGESCVFIPCISAAIGCSCKNKVCYRNLeonia cymosa (Sacha uba)Antimicrobial, Antiviral10813905,18008336
DRAMP00800Cycloviolin-B (Plant defensin)GTACGESCYVLPCFTVGCTCTSSQCFKNLeonia cymosa (Sacha uba)Antimicrobial, Antiviral10813905,18008336
DRAMP00801Cycloviolin-C (Plant defensin)GIPCGESCVFIPCLTTVAGCSCKNKVCYRNLeonia cymosa (Sacha uba)Antimicrobial, Antiviral10813905,18008336
DRAMP00802Cycloviolin-D (Plant defensin)GFPCGESCVFIPCISAAIGCSCKNKVCYRNLeonia cymosa (Sacha uba)Antimicrobial, Antiviral10813905,18008336
DRAMP00803Palicourein (Cyclotides; Plants)GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRNPalicourea condensata (Cappel)Antimicrobial, Antiviral11430013,14725768,18008336
DRAMP00816Cycloviolacin-O13 (Cyclotide c3; Plant defensin)GIPCGESCVWIPCISAAIGCSCKSKVCYRNViola odorata (Sweet violet)Antiviral,Insecticidal 16872274,18008336
DRAMP00817Cycloviolacin-O14 (Plant defensin)GSIPACGESCFKGKCYTPGCSCSKYPLCAKNViola odorata (Sweet violet)Antiviral,Insecticidal 16872274,18008336
DRAMP00828Cycloviolacin-O24 (Plant defensin)GLPTCGETCFGGTCNTPGCTCDPWPVCTHNViola odorata (Sweet violet)Antiviral,Insecticidal 16872274,18008336
DRAMP00831Cycloviolacin-H3 (Plant defensin)GLPVCGETCFGGTCNTPGCICDPWPVCTRNViola hederacea (Australian violet)Antimicrobial, Antiviral10600388
DRAMP00832Cycloviolacin-H4 (Plant defensin)GIPCAESCVWIPCTVTALLGCSCSNNVCYNViola hederacea (Australian violet)Antimicrobial, Antiviral10600388
DRAMP00833Cycloviolacin-Y1 (Plants)GGTIFDCGETCFLGTCYTPGCSCGNYGFCYGTNViola yedoensis (Chinese herb)Antimicrobial, Antiviral18081258,18008336
DRAMP00834Cycloviolacin-Y2 (Plants)GGTIFDCGESCFLGTCYTAGCSCGNWGLCYGTNViola yedoensis (Chinese herb)Antimicrobial, Antiviral18081258
DRAMP00835Cycloviolacin-Y3 (Plants)GGTIFDCGETCFLGTCYTAGCSCGNWGLCYGTNViola yedoensis (Chinese herb)Antimicrobial, Antiviral18081258
DRAMP00836Cycloviolacin-Y4 (Plants)GVPCGESCVFIPCITGVIGCSCSSNVCYLNViola yedoensis (Chinese herb)Antimicrobial, Antiviral18081258,18008336,18618891
DRAMP00837Cycloviolacin-Y5 (Plants)GIPCAESCVWIPCTVTALVGCSCSDKVCYNViola yedoensis (Chinese herb)Antimicrobial, Antiviral18081258,18008336,18618891
DRAMP00863Kalata-B8 (Plant defensin)GSVLNCGETCLLGTCYTTGCTCNKYRVCTKDOldenlandia affinisAntimicrobial, Antiviral18008336,16207177,17534989
Close
Sign in     login

Forgot your password?