Result: 21 - 40 of 2880
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00190Leucocin N (Bacteriocin)MNKEYNSISNFKKITNKDLQNINGGFIGRAIGDFVYFGAKGLRESGKLLNYYYKHKHLeuconostoc pseudomesenteroides QU 15 (Gram-positive bacteria)Antimicrobial, Antibacterial, Anti-Gram+20070442
DRAMP00201Amythiamicin A/B (Bacteriocin)SCNCVCGVCCSCSPAmycolatopsis sp. (strain MI481-42F4 / FERM P-12739)Antimicrobial, Antibacterial, Anti-Gram+8040071
DRAMP00204Thiocillin GE37468 (Antibiotic GE37468; Bacteriocin)STNCFCYICCSCSSStreptomyces sp. (Gram-positive bacteria)Antimicrobial, Antibacterial, Anti-Gram+21788474
DRAMP00218Plantazolicin (PZN; Bacteriocin)RCTCTTIISSSSTFBacillus amyloliquefaciens FZB42 & Bacillus pumilus (Bacillus mesentericus) (Gram-positive bacteria)Antimicrobial, Antibacterial, Anti-Gram+20971906
DRAMP00244Hominicin (Bacteriocin)XTPATPFTPAITEITAAVIAXStaphylococcus hominis MBBL 2-9 (Gram-positive bacteria)Antimicrobial, Antibacterial, Anti-Gram+20654578
DRAMP00254Propionicin-F (Bacteriocin)WFYQGMNIAIYANIGGVANIIGYTEAAVATLLGAVVAVAPVVPPropionibacterium freudenreichii subsp. Freudenreichii LMGT 2946 (Gram-positive bacteria)Antimicrobial, Antibacterial, Anti-Gram+15574930
DRAMP00275Snakin-1 (StSN1; Cys-rich; Plant defensin)GSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCPSolanum tuberosum (potato)Antimicrobial, Antibacterial, Anti-Gram+, Antifungal11891250,9885189
DRAMP00336ChaC7 (Chassatide C7; uncyclotides; Plant defensin)IPCGESCVWIPCITAIAGCSCKNKVCYTChassalia chartaceaAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-22467870
DRAMP00337ChaC8 (Chassatide C8; uncyclotides; Plant defensin)AIPCGESCVWIPCISTVIGCSCSNKVCYRChassalia chartaceaAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-22467870
DRAMP00338ChaC11 (Chassatide C11; uncyclotides; Plant defensin)IPCGESCVWIPCISGMFGCSCKDKVCYSChassalia chartaceaAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-22467870
DRAMP00431Defensin-like protein 2 (Cp-thionin II; Cp-thionin-2; Gamma-thionin II; Plant defensin)KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNCVigna unguiculata (Cowpea)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-16824043
DRAMP00764Piceain 1 (Plants)KSLRPRCWIKIKFRCKSLKFPicea sitchensisAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal21644248
DRAMP00765Piceain 2 (Plants)RPRCWIKIKFRCKSLKFPicea sitchensisAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal21644248
DRAMP00766JCpep7 (Plants)KVFLGLKJatropha curcasAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-21268582
DRAMP00774Hedyotide B1 (hB1; Plants)GTRCGETCFVLPCWSAKFGCYCQKGFCYRNHedyotis biflora (aerial tissues)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-21979955
DRAMP00795Cliotide T1 (cT1; Plant defensin)GIPCGESCVFIPCITAAIGCSCKSKVCYRNClitoria ternatea (Butterfly pea)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anti-cancer21596752
DRAMP00798Cliotide T4 (cT4; Plant defensin)GIPCGESCVFIPCITGAIGCSCKSKVCYRNClitoria ternatea (Butterfly pea)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anti-cancer21596752
DRAMP00856Kalata-B1 (Plant defensin)GLPVCGETCVGGTCNTPGCTCSWPVCTRNOldenlandia affinis Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral18008336,10430870,7703226,17534989,23129773
DRAMP00877Circulin-A (CIRA; Plant defensin)GIPCGESCVWIPCISAALGCSCKNKVCYRNChassalia parviflora Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal18008336,10430870,9878410,8920961
DRAMP00878Circulin-B (CIRB; Plant defensin)GVIPCGESCVFIPCISTLLGCSCKNKVCYRNChassalia parviflora Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal10430870,18008336,8920961
Close
Sign in     login

Forgot your password?