Result: 61 - 80 of 2880
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP01154Ala7-uperin 3.6 (toads, amphibians, animals)GVIDAAAKVVNVLKNLFUperoleia mjobergii (Australian toadlet)Antimicrobial, Antibacterial, Anti-Gram+10461748
DRAMP01155Ala14-uperin 3.6 (toads, amphibians, animals)GVIDAAKKVVNVLANLFUperoleia mjobergii (Australian toadlet)Antimicrobial, Antibacterial, Anti-Gram+10461748
DRAMP01162Buforin-1 (Buforin I; Fragment of Histone H2A; toads, amphibians, animals)AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNYBufo gargarizans (Asian toad) (Bufo bufo gargarizans)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal8573171,8946958
DRAMP01163Buforin-2 (Buforin II; Fragment of Histone H2A; toads, amphibians, animals)TRSSRAGLQFPVGRVHRLLRKBufo gargarizans (Asian toad) (Bufo bufo gargarizans)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal8573171,8946958
DRAMP01164Bombinin (toads, amphibians, animals)GIGALSAKGALKGLAKGLAEHFANBombina variegata (Yellow-bellied toad)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-PubMed ID is not available,8223491
DRAMP01167Hylaseptin-P1 (HSP1)GILDAIKAIAKAAGHyla punctata (Polka-dot tree frog) (Spotted tree frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-14715660
DRAMP01170Distinctin 2 (Frogs, amphibians, animals)NLVSGLIEARKYLEQLHRKLKNCKVPhyllomedusa distincta (Tree frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-11297740
DRAMP01174Ocellatin-4 (Frogs, amphibians, animals)GLLDFVTGVGKDIFAQLIKQILeptodactylus ocellatus (Argus frog) (Leptodactylus macrosternum)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-17884127
DRAMP01182Ocellatin-P1 (Pentadactylin; Frogs, amphibians, animals)GLLDTLKGAAKNVVGSLASKVMEKLLeptodactylus pentadactylus (South American bullfrog) Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-16236555
DRAMP01184SPX(1-22)(truncated peptide of Syphaxin; Frogs, amphibians, animals)GVLDILKGAAKDLAGHVATKVILeptodactylus syphax (Burgundy thin-toed frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-17628627
DRAMP01185SPX(1-16)(truncated peptide of Syphaxin; Frogs, amphibians, animals)GVLDILKGAAKDLAGHLeptodactylus syphax (Burgundy thin-toed frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-17628627
DRAMP01188Chensinin-1ZHa (Frogs, amphibians, animals)LALKSGGWLRLFGLKDKKHRana zhenhaiensis (Chinese brown frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22943778
DRAMP01189Andersonin-W1 (Frogs, amphibians, animals)ATNIPFKVHFRCKAAFCOdorrana andersonii (Golden crossband frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22029824
DRAMP01190Andersonin-W2 (Frogs, amphibians, animals)AVNIPFKVHFRCKAAFCOdorrana andersonii (Golden crossband frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22029824
DRAMP01191Andersonin-X1 (Frogs, amphibians, animals)GLFSKFAGKGIVNFLIEGVEOdorrana andersonii (Golden crossband frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22029824
DRAMP01192Andersonin-Y1 (Frogs, amphibians, animals)FLPKLFAKITKKNMAHIROdorrana andersonii (Golden crossband frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22029824
DRAMP01194Andersonin-C1 (Frogs, amphibians, animals)TSRCIFYRRKKCSOdorrana andersonii (Golden crossband frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22029824
DRAMP01195Andersonin-D1 (Frogs, amphibians, animals)FIFPKKNIINSLFGROdorrana andersonii (Golden crossband frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22029824
DRAMP01199Hejiangin-A1 (Frogs, amphibians, animals)RFIYMKGFGKPRFGKROdorrana hejiangensisAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22029824
DRAMP01200Hejiangin-F1 (frog, amphibians, animals)IPWKLPATFRPVERPFSKPFCRKDOdorrana hejiangensisAntimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22029824
Close
Sign in     login

Forgot your password?