Result: 21 - 40 of 148
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP01743Temporin-F (Frogs, amphibians, animals)FLPLIGKVLSGILRana temporaria (European common frog)Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic, Antimicrobial9022710
DRAMP02902L-amino-acid oxidase (LAAO, LAO; BpirLAAO-I; reptilia, animals)ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAYBothrops pirajai (Piraja's lance head)Antibacterial, Antiparasitic, Anti-Gram-, Antimicrobial16809041
DRAMP03064Alloferon-1 (Insects, animals)HGVSGHGQHGVHGCalliphora vicina (Blue blowfly) (Calliphora erythrocephala)Antiparasitic, Antiviral, Antitumor, Antimicrobial12235362
DRAMP03094Drosomycin-2 (Insects, animals)DCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCEGCDrosophila melanogaster (Fruit fly)Antifungal, Antiparasitic, Antimicrobial18657321
DRAMP03469Serine protease inhibitor Cvsi-1 (molluscs, animals)MDVVRTLILCVCLFGLTFACrassostrea virginica (Eastern oyster)Antibacterial, Antiparasitic, Antimicrobial16872855,19720077
DRAMP03557Granulysin (Lymphokine LAG-2; Human, mammals, animals)GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLHomo sapiens (Human)Antibacterial, Antifungal, Antiparasitic, Antimicrobial9756476,12488100
DRAMP03558human platelet factor 4 (hPF4; Human, mammals, animals)EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLESHomo sapiens (Human)Antiparasitic23245326
DRAMP03559CXCL10 (Human, mammals, animals)VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSPHomo sapiens (Human)Antibacterial, Antiparasitic, Antimicrobial12949249,12737818
DRAMP03560CXC chemokine GRObeta [5-73] (Human, mammals, animals)TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSNHomo sapiens (Human)Antibacterial, Antiparasitic, Chemotactic, Antimicrobial12949249,10600366
DRAMP03561CXCL6 (C-X-C motif chemokine 6; Human, mammals, animals)GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKNHomo sapiens (Human)Antibacterial, Antiparasitic, Antimicrobial18443119
DRAMP18210Amythiamicin C/D(Bacteriocin)SCNCVCGVCCSCAmycolatopsis sp. (strain MI481-42F4 / FERM P-12739)Antibacterial,Antiparasitic, Anti-Gram+, Antimicrobial8040071,7961166,16262432
DRAMP18202WB Piscidin 5 (fish, animals; UCLL1a)LIGSLFRGAKAIFRGARQGWRSHKAVSRYRARYVRRPVIYYHRVYPMorone chrysopsAnti-Gram+ & Gram-, Antiparasitic27552222
DRAMP18201WB Piscidin 6 (fish, animals; UCLL1a)LFGSVKAWFKGAKKGFQDYRYQKDMAKMNKRYGPNWQQRGGQEPPADAQANDQPPMorone chrysopsAnti-Gram+, Antiparasitic27552222
DRAMP18200SB Piscidin 6 (fish, animals; UCLL1a)FFGRLKSMWRGARGGLKAYKYQKDMAKMNKRYGPNWQQGGGQEPPADAQANDQPPMorone saxatilisAnti-Gram+, Antiparasitic27552222
DRAMP04673Alamethicin (ALM; fungi)PAAAAQAVAGLAPVAAEQTrichoderma virideAntibacterial, Antifungal, Antiparasitic, AntimicrobialPubMed ID is not available,6292726
DRAMP04700Basic phospholipase A2 BnpTX-1 (BnPTx-I, svPLA2; Phosphatidylcholine 2-acylhydrolase)DLWQFGKMILKVAGKLPFPYYGAYGCYCGWGGRGKPKDPTDRCCFVHDCCBothrops pauloensis (Neuwied's lancehead) (Bothrops neuwiedipauloensis)Antibacterial, Antiparasitic, Anti-Gram+, Anti-Gram-, Antimicrobial15302537
DRAMP04701Phospholipase A2 homolog (BmarPLA2, svPLA2 homolog)SLLELGKMILQETGKMPSKSYGAYGCNCGVLGRBothrops marajoensis (Marajo lancehead)Antibacterial, Antiparasitic, Antimicrobial19944711
DRAMP04952Sequence 1 from Patent US 20030186854XCRRLCYKQRCVTYCRGRArachinidAntiparasitic, Antifungal, AntibacterialNo pubmed id
DRAMP04953Sequence 2 from Patent US 20030186854XCRRLCYKQRCVTYCRGXArachinidAntiparasitic, Antifungal, AntibacterialNo pubmed id
DRAMP04954Sequence 3 from Patent US 20030186854XCKRLCYKQRCVTYCRGRArachinidAntiparasitic, Antifungal, AntibacterialNo pubmed id
Disclaimer:
The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk.
Close
Sign in     login

Forgot your password?