Activity-Browse

Result: 1 - 17 of 17

DownLoad :

FASTA

HTML

XLS

XML

DRAMP ID	Peptide NAME	Peptide Sequence	Source	Biological Activity	Pubmed ID
DRAMP01257	Dermadistinctin-K (DD K; Frogs, amphibians, animals)	GLWSKIKAAGKEAAKAAAKAAGKAALNAVSEAV	Phyllomedusa distincta (Monkey frog)	Antibacterial, Antifungal, Antiprotozoal, Anti-Gram+, Anti-Gram-, Antimicrobial	10477123
DRAMP01258	Dermadistinctin-L (DD L; Frogs, amphibians, animals)	ALWKTLLKNVGKAAGKAALNAVTDMVNQ	Phyllomedusa distincta (Monkey frog)	Antibacterial, Antifungal, Antiprotozoal, Anti-Gram+, Anti-Gram-, Antimicrobial	10477123,12379643,17409003,17442605
DRAMP01301	Phylloseptin-1 (PS-1; Frogs, amphibians, animals)	FLSLIPHAINAVSAIAKHN	Phyllomedusa hypochondrialis (Orange-legged leaf frog)	Antibacterial, Antifungal, Antiprotozoal, Anti-Gram+, Anti-Gram-, Antimicrobial	15752569,18656510
DRAMP01639	Dermaseptin-1 (DShypo01, DPh-1; Frogs, amphibians, animals)	GLWSTIKNVGKEAAIAAGKAALGAL	Phyllomedusa hypochondrialis (Orange-legged leaf frog)	Antibacterial, Antiprotozoal, Anti-Gram+, Anti-Gram-, Antimicrobial	16844081,16963159
DRAMP01643	Dermaseptin-5 (DShypo05, DS 01; Frogs, amphibians, animals)	GLWSTIKQKGKEAAIAAAKAAGQAALGAL	Phyllomedusa hypochondrialis (Orange-legged leaf frog)	Antibacterial, Antiprotozoal, Anti-Gram+, Anti-Gram-, Antimicrobial	8306981
DRAMP01668	Dermaseptin-1 (DS I; Dermaseptin-S1, DS1; Frogs, amphibians, animals)	ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ	Phyllomedusa sauvagei (Sauvage's leaf frog)	Antibacterial, Antifungal, Antiprotozoal, Anti-Gram+, Anti-Gram-, Antimicrobial	1909573,8306981
DRAMP02271	Magainin-2 (Magainin II; chain of Magainins; Frogs, amphibians, animals)	GIGKFLHSAKKFGKAFVGEIMNS	Xenopus laevis (African clawed frog)	Antibacterial, Antifungal, Antiprotozoal, Anti-Gram+, Anti-Gram-, Antimicrobial	3299384,9090128,PubMed ID is not available
DRAMP02294	Gaegurin-4 (Gaegurin 4; GGN4; Frogs, amphibians, animals)	GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC	Glandirana rugosa (Japanese wrinkled frog) (Rana rugosa)	Antibacterial, Antifungal, Antiprotozoal, Anti-Gram+, Anti-Gram-, Antimicrobial	7999137,17141187,11004488
DRAMP02295	Gaegurin-5 (Gaegurin 5; GGN5; Brevinin-1EMa; Frogs, amphibians, animals)	FLGALFKVASKVLPSVFCAITKKC	Glandirana rugosa (Japanese wrinkled frog) (Rana rugosa)	Antibacterial, Antifungal, Antiprotozoal, Anti-Gram+, Anti-Gram-, Antimicrobial	7999137
DRAMP01292	Phylloseptin-4 (PS-4; Frogs, amphibians, animals)	FLSLIPHAINAVSTLVHHSG	Phyllomedusa oreades (Orange-legged leaf frog) (Monkey frog)	Antiprotozoal	15752569
DRAMP01293	Phylloseptin-5 (PS-5; Frogs, amphibians, animals)	FLSLIPHAINAVSAIAKHS	Phyllomedusa oreades (Orange-legged leaf frog) (Monkey frog)	Antiprotozoal	15752569
DRAMP01669	Dermaseptin-2 (DS II; Dermaseptin-S2, DS2; Frogs, amphibians, animals)	ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ	Phyllomedusa sauvagei (Sauvage's leaf frog)	Antibacterial, Antifungal, Antiprotozoal, Antimicrobial	8306981
DRAMP01670	Dermaseptin-3 (DS III; Dermaseptin-S3, DS3; Frogs, amphibians, animals)	ALWKNMLKGIGKLAGKAALGAVKKLVGAES	Phyllomedusa sauvagei (Sauvage's leaf frog)	Antibacterial, Antifungal, Antiprotozoal, Antimicrobial	8306981,9395500
DRAMP03062	Defensin-A (DefA; GmDefA; Insects, animals)	VTGELKRDKRVTCNIGEWVCVAHCNSKSKKSGYCSRGVCYCTN	Glossina morsitans morsitans (Savannah tsetse fly)	Antibacterial, Antiprotozoal, Anti-Gram-, Antimicrobial	11592981,11886771
DRAMP03110	Andropin (Insects, animals)	VFIDILDKMENAIHKAAQAGIGIAKPIEKMILPK	Drosophila mauritiana (Fruit fly)	Antibacterial, Antiprotozoal, Antimicrobial	11965438
DRAMP03183	Naegleriapore A (Predicted)	DAECEICKFVIQQVEAFIESNHSQAEIQKELNKL	Naegleria fowleri (Brain eating amoeba)	Antibacterial, Antiprotozoal, Cytotoxici, Anti-Gram+, Anti-Gram-, Antimicrobial	11948186
DRAMP03184	Naegleriapore B (Predicted)	SVIGCEICEWLVATAEGFVNKTKPQIEQELLQICAKLGPYEQICDQLVLMELPDIIDQIIAKEPPAIVCSQVKICNG	Naegleria fowleri (Brain eating amoeba)	Antibacterial, Antiprotozoal, Cytotoxici, Anti-Gram+, Anti-Gram-, Antimicrobial	11948186

Disclaimer:
The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk.