Result: 41 - 60 of 2880
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP04532Myxinidin (Hagfish, animals)GIHDILKYGKPSMyxine glutinosa (Atlantic hagfish)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-19330556
DRAMP02993Abaecin (Pro-rich; insects, arthropods, invertebrates, animals)YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGYApis mellifera (Honeybee)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-2298215,7961803
DRAMP01016Antimicrobial peptide 1 (MJ-AMP1; Plant defensin)QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNRMirabilis jalapa (Garden four-o'clock)Antimicrobial, Antibacterial, Anti-Gram+, Antifungal1733929,7647302
DRAMP01017Antimicrobial peptide 2 (MJ-AMP2; Plant defensin)CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNRMirabilis jalapa (Garden four-o'clock)Antimicrobial, Antibacterial, Anti-Gram+, Antifungal1733929,7647302
DRAMP01018Cyclopsychotride-A (CPT; Plant defensin)SIPCGESCVFIPCTVTALLGCSCKSKVCYKNPsychotria longipes Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal10430870,7714530
DRAMP01064Anticancerous peptide 1 (Cr-ACP1; Plants)AWKLFDDGVCycas revoluta (Sago palm)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anti-cancer21882228
DRAMP01082Alyteserin-2a (toads, amphibians, animals)ILGKLLSTAAGLLSNLAlytes obstetricans (European midwife toad)Antimicrobial, Antibacterial, Anti-Gram+, Cytotoxicity19463738
DRAMP01088Alyteserin-1Ma (toads, amphibians, animals)GFKEVLKADLGSLVKGIAAHVANAlytes maurus (Midwife toad)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22800568
DRAMP01089Alyteserin-1Mb (toads, amphibians, animals)GFKEVLKAGLGSLVKGIPAHVANAlytes maurus (Midwife toad)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22800568
DRAMP01090Alyteserin-2Ma (toads, amphibians, animals)FIGKLISAASGLLSHLAlytes maurus (Midwife toad)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22800568
DRAMP01091Alyteserin-2Mb (toads, amphibians, animals)ILGAIIPLVSGLLSHLAlytes maurus (Midwife toad)Antimicrobial, Antibacterial, Anti-Gram+, Antifungal22800568
DRAMP01392Odorranain-V1 (OdV1; Frogs, amphibians, animals)GLLSGTSVRGSIOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal17272268
DRAMP01391Odorranain-U1 (OdU1; Frogs, amphibians, animals)GCSRWIIGIHGQICRDOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01390Odorranain-T1 (OdT1; Frogs, amphibians, animals)TSRCYIGYRRKVVCSOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01389Odorranain-S1 (OdS1; Frogs, amphibians, animals)FLPPSPWKETFRTSOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01387Odorranain-P2a (OdP2a; Frogs, amphibians, animals)GLLSGILGAGKHIVCGLSGPCQSLNRKSSDVEYHLAKCOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01386Odorranain-P1a (OdP1a; Brevinin-1HS1; Brevinin-1-OA2; Frogs, amphibians, animals)VIPFVASVAAEMMQHVYCAASKKCOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal17272268
DRAMP01151Uperin-3.5 (toads, amphibians, animals)GVGDLIRKAVSVIKNIVUperoleia mjobergii (Australian toadlet)Antimicrobial, Antibacterial, Anti-Gram+PubMed ID is not available,15203252
DRAMP01152Uperin-3.6 (toads, amphibians, animals)GVIDAAKKVVNVLKNLPUperoleia mjobergii (Australian toadlet)Antimicrobial, Antibacterial, Anti-Gram+10461748,15203252
DRAMP01153Ala4-uperin 3.6 (toads, amphibians, animals)GVIAAAKKVVNVLKNLFUperoleia mjobergii (Australian toadlet)Antimicrobial, Antibacterial, Anti-Gram+10461748
Close
Sign in     login

Forgot your password?