Result: 1 - 20 of 2519
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP04532Myxinidin (Hagfish, animals)GIHDILKYGKPSMyxine glutinosa (Atlantic hagfish)Antimicrobial, Anti-Gram+, Anti-Gram-19330556
DRAMP02993Abaecin (Pro-rich; insects, arthropods, invertebrates, animals)YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGYApis mellifera (Honeybee)Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial2298215,7961803
DRAMP01081Alyteserin-1a (toads, amphibians, animals)GLKDIFKAGLGSLVKGIAAHVANAlytes obstetricans (European midwife toad)Antibacterial, Anti-Gram-, Antimicrobial19463738
DRAMP01082Alyteserin-2a (toads, amphibians, animals)ILGKLLSTAAGLLSNLAlytes obstetricans (European midwife toad)Antibacterial, Cytotoxicity, Anti-Gram+, Antimicrobial19463738
DRAMP01083Alyteserin-1b (toads, amphibians, animals)GLKEIFKAGLGSLVKGIAAHVANAlytes obstetricans (European midwife toad)Antibacterial, Anti-Gram-, Antimicrobial19463738
DRAMP01085Alyteserin-1c (toads, amphibians, animals)GLKEIFKAGLGSLVKGIAAHVASAlytes obstetricans (Common midwife toad) (Bufo obstetricans)Antibacterial, Anti-Gram-, Antimicrobial21565166,19463738
DRAMP01088Alyteserin-1Ma (toads, amphibians, animals)GFKEVLKADLGSLVKGIAAHVANAlytes maurus (Midwife toad)Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial22800568
DRAMP01089Alyteserin-1Mb (toads, amphibians, animals)GFKEVLKAGLGSLVKGIPAHVANAlytes maurus (Midwife toad)Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial22800568
DRAMP01090Alyteserin-2Ma (toads, amphibians, animals)FIGKLISAASGLLSHLAlytes maurus (Midwife toad)Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial22800568
DRAMP01091Alyteserin-2Mb (toads, amphibians, animals)ILGAIIPLVSGLLSHLAlytes maurus (Midwife toad)Antibacterial, Antifungal, Anti-Gram+, Antimicrobial22800568
DRAMP01096Bombinin-like peptide 2 (BLP-2; toads, amphibians, animals)GIGSAILSAGKSALKGLAKGLAEHFANBombina orientalis (Oriental fire-bellied toad)Antibacterial, Antifungal, Anti-Gram-, Antimicrobial1744108
DRAMP01097Bombinin-like peptide 1 (toads, amphibians, animals)GIGASILSAGKSALKGLAKGLAEHFANBombina orientalis (Oriental fire-bellied toad)Antimicrobial1744108
DRAMP01098Bombinin-like peptide 3 (BLP-3; toads, amphibians, animals)GIGAAILSAGKSALKGLAKGLAEHFBombina orientalis (Oriental fire-bellied toad)Antibacterial, Anti-Gram-, Antimicrobial1744108
DRAMP01105Maximin-S4 (chain of Maximins-S type B/C; toads, amphibians, animals)RSNKGFNFMVDMIQALSKBombina maxima (Giant fire-bellied toad) (Chinese red belly toad)Antibacterial, Antimicrobial15649437
DRAMP01392Odorranain-V1 (OdV1; Frogs, amphibians, animals)GLLSGTSVRGSIOdorrana grahami (Yunnanfu frog) (Rana grahami)Antibacterial, Antifungal , Anti-Gram+, Anti-Gram-, Antimicrobial17272268
DRAMP01391Odorranain-U1 (OdU1; Frogs, amphibians, animals)GCSRWIIGIHGQICRDOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01390Odorranain-T1 (OdT1; Frogs, amphibians, animals)TSRCYIGYRRKVVCSOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01388Odorranain-R1 (OdR1; Frogs, amphibians, animals)GFSPNLPGKGLRISOdorrana grahami (Yunnanfu frog) (Rana grahami)Antifungal, Antimicrobial17272268
DRAMP01389Odorranain-S1 (OdS1; Frogs, amphibians, animals)FLPPSPWKETFRTSOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01387Odorranain-P2a (OdP2a; Frogs, amphibians, animals)GLLSGILGAGKHIVCGLSGPCQSLNRKSSDVEYHLAKCOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
Close
Sign in     login

Forgot your password?