Result: 1 - 20 of 2519
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP04532Myxinidin (Hagfish, animals)GIHDILKYGKPSMyxine glutinosa (Atlantic hagfish)Antimicrobial, Anti-Gram+, Anti-Gram-19330556
DRAMP02993Abaecin (Pro-rich; insects, arthropods, invertebrates, animals)YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGYApis mellifera (Honeybee)Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial2298215,7961803
DRAMP01081Alyteserin-1a (toads, amphibians, animals)GLKDIFKAGLGSLVKGIAAHVANAlytes obstetricans (European midwife toad)Antibacterial, Anti-Gram-, Antimicrobial19463738
DRAMP01082Alyteserin-2a (toads, amphibians, animals)ILGKLLSTAAGLLSNLAlytes obstetricans (European midwife toad)Antibacterial, Cytotoxicity, Anti-Gram+, Antimicrobial19463738
DRAMP01083Alyteserin-1b (toads, amphibians, animals)GLKEIFKAGLGSLVKGIAAHVANAlytes obstetricans (European midwife toad)Antibacterial, Anti-Gram-, Antimicrobial19463738
DRAMP01085Alyteserin-1c (toads, amphibians, animals)GLKEIFKAGLGSLVKGIAAHVASAlytes obstetricans (Common midwife toad) (Bufo obstetricans)Antibacterial, Anti-Gram-, Antimicrobial21565166,19463738
DRAMP01088Alyteserin-1Ma (toads, amphibians, animals)GFKEVLKADLGSLVKGIAAHVANAlytes maurus (Midwife toad)Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial22800568
DRAMP01089Alyteserin-1Mb (toads, amphibians, animals)GFKEVLKAGLGSLVKGIPAHVANAlytes maurus (Midwife toad)Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial22800568
DRAMP01090Alyteserin-2Ma (toads, amphibians, animals)FIGKLISAASGLLSHLAlytes maurus (Midwife toad)Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial22800568
DRAMP01091Alyteserin-2Mb (toads, amphibians, animals)ILGAIIPLVSGLLSHLAlytes maurus (Midwife toad)Antibacterial, Antifungal, Anti-Gram+, Antimicrobial22800568
DRAMP01096Bombinin-like peptide 2 (BLP-2; toads, amphibians, animals)GIGSAILSAGKSALKGLAKGLAEHFANBombina orientalis (Oriental fire-bellied toad)Antibacterial, Antifungal, Anti-Gram-, Antimicrobial1744108
DRAMP01097Bombinin-like peptide 1 (toads, amphibians, animals)GIGASILSAGKSALKGLAKGLAEHFANBombina orientalis (Oriental fire-bellied toad)Antimicrobial1744108
DRAMP01098Bombinin-like peptide 3 (BLP-3; toads, amphibians, animals)GIGAAILSAGKSALKGLAKGLAEHFBombina orientalis (Oriental fire-bellied toad)Antibacterial, Anti-Gram-, Antimicrobial1744108
DRAMP01105Maximin-S4 (chain of Maximins-S type B/C; toads, amphibians, animals)RSNKGFNFMVDMIQALSKBombina maxima (Giant fire-bellied toad) (Chinese red belly toad)Antibacterial, Antimicrobial15649437
DRAMP01392Odorranain-V1 (OdV1; Frogs, amphibians, animals)GLLSGTSVRGSIOdorrana grahami (Yunnanfu frog) (Rana grahami)Antibacterial, Antifungal , Anti-Gram+, Anti-Gram-, Antimicrobial17272268
DRAMP01391Odorranain-U1 (OdU1; Frogs, amphibians, animals)GCSRWIIGIHGQICRDOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01390Odorranain-T1 (OdT1; Frogs, amphibians, animals)TSRCYIGYRRKVVCSOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01388Odorranain-R1 (OdR1; Frogs, amphibians, animals)GFSPNLPGKGLRISOdorrana grahami (Yunnanfu frog) (Rana grahami)Antifungal, Antimicrobial17272268
DRAMP01389Odorranain-S1 (OdS1; Frogs, amphibians, animals)FLPPSPWKETFRTSOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01387Odorranain-P2a (OdP2a; Frogs, amphibians, animals)GLLSGILGAGKHIVCGLSGPCQSLNRKSSDVEYHLAKCOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk.
Sign in     login

Forgot your password?