Result: 21 - 40 of 2713
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP04532Myxinidin (Hagfish, animals)GIHDILKYGKPSMyxine glutinosa (Atlantic hagfish)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-19330556
DRAMP02993Abaecin (Pro-rich; insects, arthropods, invertebrates, animals)YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGYApis mellifera (Honeybee)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-2298215,7961803
DRAMP01012Pg-AMP (Gly-rich; Plants)RESPSSRMECYEQAERYGYGGYGGGRYGGGYGSGRGQPVGQGVERSHDDNRNQPRPsidium guajava (Guava)Antimicrobial, Antibacterial, Anti-Gram-18448201
DRAMP01018Cyclopsychotride-A (CPT; Plant defensin)SIPCGESCVFIPCTVTALLGCSCKSKVCYKNPsychotria longipes Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal10430870,7714530
DRAMP01064Anticancerous peptide 1 (Cr-ACP1; Plants)AWKLFDDGVCycas revoluta (Sago palm)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anti-cancer21882228
DRAMP01066Kunitz-type serine protease inhibitor 1 (Xb-KTI; Plants)PVVDTTGNNPLQQQEEYYVXanthosoma sagittifolium (Elephant's ear) (Arum sagittifolium)Antimicrobial, Antibacterial, Anti-Gram-21520894
DRAMP01081Alyteserin-1a (toads, amphibians, animals)GLKDIFKAGLGSLVKGIAAHVANAlytes obstetricans (European midwife toad)Antimicrobial, Antibacterial, Anti-Gram-19463738
DRAMP01083Alyteserin-1b (toads, amphibians, animals)GLKEIFKAGLGSLVKGIAAHVANAlytes obstetricans (European midwife toad)Antimicrobial, Antibacterial, Anti-Gram-19463738
DRAMP01085Alyteserin-1c (toads, amphibians, animals)GLKEIFKAGLGSLVKGIAAHVASAlytes obstetricans (Common midwife toad) (Bufo obstetricans)Antimicrobial, Antibacterial, Anti-Gram-21565166,19463738
DRAMP01088Alyteserin-1Ma (toads, amphibians, animals)GFKEVLKADLGSLVKGIAAHVANAlytes maurus (Midwife toad)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22800568
DRAMP01089Alyteserin-1Mb (toads, amphibians, animals)GFKEVLKAGLGSLVKGIPAHVANAlytes maurus (Midwife toad)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22800568
DRAMP01090Alyteserin-2Ma (toads, amphibians, animals)FIGKLISAASGLLSHLAlytes maurus (Midwife toad)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal22800568
DRAMP01096Bombinin-like peptide 2 (BLP-2; toads, amphibians, animals)GIGSAILSAGKSALKGLAKGLAEHFANBombina orientalis (Oriental fire-bellied toad)Antimicrobial, Antibacterial, Anti-Gram-, Antifungal1744108
DRAMP01098Bombinin-like peptide 3 (BLP-3; toads, amphibians, animals)GIGAAILSAGKSALKGLAKGLAEHFBombina orientalis (Oriental fire-bellied toad)Antimicrobial, Antibacterial, Anti-Gram-1744108
DRAMP01392Odorranain-V1 (OdV1; Frogs, amphibians, animals)GLLSGTSVRGSIOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal17272268
DRAMP01391Odorranain-U1 (OdU1; Frogs, amphibians, animals)GCSRWIIGIHGQICRDOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01390Odorranain-T1 (OdT1; Frogs, amphibians, animals)TSRCYIGYRRKVVCSOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01389Odorranain-S1 (OdS1; Frogs, amphibians, animals)FLPPSPWKETFRTSOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01387Odorranain-P2a (OdP2a; Frogs, amphibians, animals)GLLSGILGAGKHIVCGLSGPCQSLNRKSSDVEYHLAKCOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-17272268
DRAMP01386Odorranain-P1a (OdP1a; Brevinin-1HS1; Brevinin-1-OA2; Frogs, amphibians, animals)VIPFVASVAAEMMQHVYCAASKKCOdorrana grahami (Yunnanfu frog) (Rana grahami)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal17272268
Close
Sign in     login

Forgot your password?