Result: 1 - 20 of 1888
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00877Circulin-A (CIRA; Plant defensin)GIPCGESCVWIPCISAALGCSCKNKVCYRNChassalia parviflora Antibacterial, Antifungal, Antiviral10430870,9878410
DRAMP00878Circulin-B (CIRB; Plant defensin)GVIPCGESCVFIPCISTLLGCSCKNKVCYRNChassalia parviflora Antibacterial, Antifungal, Antiviral10430870,
DRAMP01107Maximin-1 (toads, amphibians, animals)GIGTKILGGVKTALKGALKELASTYANBombina maxima (Giant fire-bellied toad) (Chinese red belly toad)Antibacterial, Antifungal, Antiviral11835991,PubMed ID is not available
DRAMP01109Maximin-3 (toads, amphibians, animals)GIGGKILSGLKTALKGAAKELASTYLHBombina maxima (Giant fire-bellied toad) (Chinese red belly toad)Antibacterial, Antifungal, Antiviral11835991
DRAMP01110Maximin-4 (toads, amphibians, animals)GIGGVLLSAGKAALKGLAKVLAEKYANBombina maxima (Giant fire-bellied toad) (Chinese red belly toad)Antibacterial, Antifungal, Antiviral15770703,11835991
DRAMP01111Maximin-5 (toads, amphibians, animals)SIGAKILGGVKTFFKGALKELASTYLQBombina maxima (Giant fire-bellied toad) (Chinese red belly toad)Antibacterial, Antifungal, Antiviral15770703,11835991
DRAMP01364Maculatin-1.1 (Frogs, amphibians, animals)GLFGVLAKVAAHVVPAIAEHFLitoria genimaculata (Green-eyed tree frog)Antibacterial, Antifungal, Antiviral9620615,15203252
DRAMP01549Caerin-1.1 (Frogs, amphibians, animals)GLLSVLGSVAKHVLPHVVPVIAEHLLitoria splendida (Magnificent tree frog) (Litoria gilleni) (Litoria caerulea)Antibacterial, Antiviral9266696,12709067,15203252
DRAMP01560Caerin-1.9 (Frogs, amphibians, animals)GLFGVLGSIAKHVLPHVVPVIAEKLLitoria chloris (Blue-thighed frog) (frog skin active peptide family)Antibacterial, Antifungal, Antiviral9516047,15203252
DRAMP01574Caerin-4.1 (Frogs, amphibians, animals)GLWQKIKSAAGDLASGIVEGIKSLitoria caerulea (Green tree frog)Antibacterial, AntiviralPubMed ID is not available,15203252
DRAMP01784Temporin-LTc (Frogs, amphibians, animals)SLSRFLSFLKIVYPPAFHylarana latouchii (broad-folded frog)Antibacterial, Antiviral19022312
DRAMP01847Ascaphin-8 (Frogs, amphibians, animals)GFKDLLKGAAKALVKTVLFAscaphus truei (Coastal tailed frog)Antibacterial, Antiviral15207717
DRAMP02233Ranatuerin-6 (Frogs, amphibians, animals)FISAIASMLGKFLLithobates catesbeiana (American bullfrog) (Rana catesbeiana)Antibacterial, Antiviral9784389
DRAMP02236Ranatuerin-9 (Frogs, amphibians, animals)FLFPLITSFLSKVLLithobates catesbeiana (American bullfrog) (Rana catesbeiana)Antibacterial, Antiviral9784389
DRAMP02257Ranatuerin-2P (Ranatuerin 2P; Frogs, amphibians, animals)LMDTVKNVAKNLAGHMLDKLKCKITGCRana luteiventris (Spotted frog) (Rana pretiosa)Antibacterial, Antiviral10651828
DRAMP03113SK84 (Gly-rich; Insects, animals)SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHKDrosophila virilis (Fruit fly)Antibacterial, Antifungal, Antiviral, In19799950
DRAMP03280AcAMP (A. clavatus antimicrobial peptide)ATYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCYCAspergillus clavatus ES1Antibacterial, Antifungal, Antiviral20440534
DRAMP03422Neutrophil antibiotic peptide NP-4 (RatNP-4; Rodents, mammals, animals)ACYCRIGACVSGERLTGACGLNGRIYRLCCRRattus norvegicus (Rat)Antibacterial, Antifungal, Antiviral2543629,7594610
DRAMP03465Cicadin (Insects, animals)NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRKDDYNENYYDDVDAADVVCicada flammata Antifungal, Antiviral11814612
DRAMP03598Human beta-defensin 2 (hBD-2; Defensin, beta 2; Beta-defensin 4A; Human, mammals, animals)GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPHomo sapiens (Human)Antibacterial, Antiviral9202117,10906336,17340092
Sign in     login

Forgot your password?