Result: 1 - 20 of 2015
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00877Circulin-A (CIRA; Plant defensin)GIPCGESCVWIPCISAALGCSCKNKVCYRNChassalia parviflora Antibacterial, Antifungal, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial10430870,9878410
DRAMP00878Circulin-B (CIRB; Plant defensin)GVIPCGESCVFIPCISTLLGCSCKNKVCYRNChassalia parviflora Antibacterial, Antifungal, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial10430870,
DRAMP01364Maculatin-1.1 (Frogs, amphibians, animals)GLFGVLAKVAAHVVPAIAEHFLitoria genimaculata (Green-eyed tree frog)Antibacterial, Antifungal, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial9620615,15203252
DRAMP01549Caerin-1.1 (Frogs, amphibians, animals)GLLSVLGSVAKHVLPHVVPVIAEHLLitoria splendida (Magnificent tree frog) (Litoria gilleni) (Litoria caerulea)Antibacterial, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial9266696,12709067,15203252
DRAMP01560Caerin-1.9 (Frogs, amphibians, animals)GLFGVLGSIAKHVLPHVVPVIAEKLLitoria chloris (Blue-thighed frog) (frog skin active peptide family)Antibacterial, Antifungal, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial9516047,15203252
DRAMP01574Caerin-4.1 (Frogs, amphibians, animals)GLWQKIKSAAGDLASGIVEGIKSLitoria caerulea (Green tree frog)Antibacterial, Antiviral, Anti-Gram+, Anti-Gram-, AntimicrobialPubMed ID is not available,15203252
DRAMP01784Temporin-LTc (Frogs, amphibians, animals)SLSRFLSFLKIVYPPAFHylarana latouchii (broad-folded frog)Antibacterial, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial19022312
DRAMP01847Ascaphin-8 (Frogs, amphibians, animals)GFKDLLKGAAKALVKTVLFAscaphus truei (Coastal tailed frog)Antibacterial, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial15207717
DRAMP02233Ranatuerin-6 (Frogs, amphibians, animals)FISAIASMLGKFLLithobates catesbeiana (American bullfrog) (Rana catesbeiana)Antibacterial, Antiviral, Anti-Gram+, Antimicrobial9784389
DRAMP02236Ranatuerin-9 (Frogs, amphibians, animals)FLFPLITSFLSKVLLithobates catesbeiana (American bullfrog) (Rana catesbeiana)Antibacterial, Antiviral, Anti-Gram+, Antimicrobial9784389
DRAMP02926Tachyplesin I (Tac; TP1; Horseshoe Crab, arachnids, Chelicerata, arthropods, invertebrates, animals)KWCFRVCYRGICYRRCRTachypleus tridentatus (Japanese horseshoe crab)Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Anti-HIV, Anticancer, Antimicrobial12369825,2229025
DRAMP03113SK84 (Gly-rich; Insects, animals)SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHKDrosophila virilis (Fruit fly)Antibacterial, Antifungal, Antiviral, In, Anti-Gram+, Antimicrobial19799950
DRAMP03280AcAMP (A. clavatus antimicrobial peptide)ATYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCYCAspergillus clavatus ES1Antibacterial, Antifungal, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial20440534
DRAMP03422Neutrophil antibiotic peptide NP-4 (RatNP-4; Rodents, mammals, animals)ACYCRIGACVSGERLTGACGLNGRIYRLCCRRattus norvegicus (Rat)Antibacterial, Antifungal, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial2543629,7594610
DRAMP03465Cicadin (Insects, animals)NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRKDDYNENYYDDVDAADVVCicada flammata Antifungal, Antiviral, Antimicrobial11814612
DRAMP03598Human beta-defensin 2 (hBD-2; Defensin, beta 2; Beta-defensin 4A; Human, mammals, animals)GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPHomo sapiens (Human)Antibacterial, Antiviral, Anti-Gram+, Anti-Gram-, Antimicrobial9202117,10906336,17340092
DRAMP04528CrusEs (cDNA encoding crustin-like peptide)TCRYWCKTPENQTYCCEDEREIPSKVGLKPGKCPPVRPVCPPTRGFFEPPKTCSNDGSCYGADKCCFDRCLGEHVCKPIQTRGChinese mitten crab, Eriocheir sinensisAntibacterial, Antifungal, Antiviral, In, Anti-Gram+, Antimicrobial20144896
DRAMP00060Bacteriocin cinnamycin (Lanthiopeptin Ro 09-0198)CRQSCSFGPFTFVCDGNTKStreptomyces cinnamoneus cinnamoneus DSM 40005 (Gram-positive bacteria)Antibacterial, Antiviral, Antimicrobial2125590,2544544,8882709
DRAMP00205Tricyclic peptide RP 71955 (Bacteriocin)CLGIGSCNDFAGCGYAVVCFWStreptomyces sp. (strain SP9440) (Gram-positive bacteria)Antiviral, Antimicrobial8270499,8286361
DRAMP00245Gramicidin A (GA; Nonribosomally synthesized bacteriocin)VGALAVVVWLWLWLWBacillus brevis (soil bacterium) (Gram-positive bacteria)Antibacterial, Antiviral, Antimicrobial19870884,8810522
Disclaimer:
The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk.
Close
Sign in     login

Forgot your password?