Result: 1 - 20 of 2042
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00877Circulin-A (CIRA; Plant defensin)GIPCGESCVWIPCISAALGCSCKNKVCYRNChassalia parviflora Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal10430870,9878410
DRAMP00878Circulin-B (CIRB; Plant defensin)GVIPCGESCVFIPCISTLLGCSCKNKVCYRNChassalia parviflora Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal10430870,
DRAMP01364Maculatin-1.1 (Frogs, amphibians, animals)GLFGVLAKVAAHVVPAIAEHFLitoria genimaculata (Green-eyed tree frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral9620615,15203252
DRAMP01549Caerin-1.1 (Frogs, amphibians, animals)GLLSVLGSVAKHVLPHVVPVIAEHLLitoria splendida (Magnificent tree frog) (Litoria gilleni) (Litoria caerulea)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral9266696,12709067,15203252
DRAMP01560Caerin-1.9 (Frogs, amphibians, animals)GLFGVLGSIAKHVLPHVVPVIAEKLLitoria chloris (Blue-thighed frog) (frog skin active peptide family)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral9516047,15203252
DRAMP01574Caerin-4.1 (Frogs, amphibians, animals)GLWQKIKSAAGDLASGIVEGIKSLitoria caerulea (Green tree frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, AntiviralPubMed ID is not available,15203252
DRAMP01784Temporin-LTc (Frogs, amphibians, animals)SLSRFLSFLKIVYPPAFHylarana latouchii (broad-folded frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral19022312
DRAMP01847Ascaphin-8 (Frogs, amphibians, animals)GFKDLLKGAAKALVKTVLFAscaphus truei (Coastal tailed frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral15207717
DRAMP02233Ranatuerin-6 (Frogs, amphibians, animals)FISAIASMLGKFLLithobates catesbeiana (American bullfrog) (Rana catesbeiana)Antimicrobial, Antibacterial, Anti-Gram+, Antiviral9784389
DRAMP02236Ranatuerin-9 (Frogs, amphibians, animals)FLFPLITSFLSKVLLithobates catesbeiana (American bullfrog) (Rana catesbeiana)Antimicrobial, Antibacterial, Anti-Gram+, Antiviral9784389
DRAMP02926Tachyplesin I (Tac; TP1; Horseshoe Crab, arachnids, Chelicerata, arthropods, invertebrates, animals)KWCFRVCYRGICYRRCRTachypleus tridentatus (Japanese horseshoe crab)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Anti-HIV, Anti-cancer12369825,2229025
DRAMP03113SK84 (Gly-rich; Insects, animals)SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHKDrosophila virilis (Fruit fly)Antimicrobial, Antibacterial, Anti-Gram+, Antifungal, Antiviral19799950
DRAMP03280AcAMP (A. clavatus antimicrobial peptide)ATYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCYCAspergillus clavatus ES1Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal20440534
DRAMP03422Neutrophil antibiotic peptide NP-4 (RatNP-4; Rodents, mammals, animals)ACYCRIGACVSGERLTGACGLNGRIYRLCCRRattus norvegicus (Rat)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal2543629,7594610
DRAMP03465Cicadin (Insects, animals)NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRKDDYNENYYDDVDAADVVCicada flammata Antimicrobial, Antifungal, Antiviral11814612
DRAMP03598Human beta-defensin 2 (hBD-2; Defensin, beta 2; Beta-defensin 4A; Human, mammals, animals)GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPHomo sapiens (Human)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral9202117,10906336,17340092
DRAMP04528CrusEs (cDNA encoding crustin-like peptide)TCRYWCKTPENQTYCCEDEREIPSKVGLKPGKCPPVRPVCPPTRGFFEPPKTCSNDGSCYGADKCCFDRCLGEHVCKPIQTRGChinese mitten crab, Eriocheir sinensisAntibacterial, Antifungal, Antiviral, In, Anti-Gram+, Antimicrobial20144896
DRAMP00060Bacteriocin cinnamycin (Lanthiopeptin Ro 09-0198)CRQSCSFGPFTFVCDGNTKStreptomyces cinnamoneus cinnamoneus DSM 40005 (Gram-positive bacteria)Antimicrobial, Antbacterial, Antiviral2125590,2544544,8882709
DRAMP00205Tricyclic peptide RP 71955 (Bacteriocin)CLGIGSCNDFAGCGYAVVCFWStreptomyces sp. (strain SP9440) (Gram-positive bacteria)Antimicrobial, Antiviral8270499,8286361
DRAMP00245Gramicidin A (GA; Nonribosomally synthesized bacteriocin)VGALAVVVWLWLWLWBacillus brevis (soil bacterium) (Gram-positive bacteria)Antimicrobial, Antbacterial, Antiviral19870884,8810522
Sign in     login

Forgot your password?