Result: 1 - 20 of 2146
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP00856Kalata-B1 (Plant defensin)GLPVCGETCVGGTCNTPGCTCSWPVCTRNOldenlandia affinis Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral18008336,10430870,7703226,17534989,23129773
DRAMP00877Circulin-A (CIRA; Plant defensin)GIPCGESCVWIPCISAALGCSCKNKVCYRNChassalia parviflora Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal18008336,10430870,9878410,8920961
DRAMP00878Circulin-B (CIRB; Plant defensin)GVIPCGESCVFIPCISTLLGCSCKNKVCYRNChassalia parviflora Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal10430870,18008336,8920961
DRAMP01364Maculatin-1.1 (Frogs, amphibians, animals)GLFGVLAKVAAHVVPAIAEHFLitoria genimaculata (Green-eyed tree frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral16140737,9620615,15203252
DRAMP01549Caerin-1.1 (Frogs, amphibians, animals)GLLSVLGSVAKHVLPHVVPVIAEHLLitoria splendida (Magnificent tree frog) (Litoria gilleni) (Litoria caerulea)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral16140737,9266696,12709067,15203252
DRAMP01555Caerin-1.5 (Frogs, amphibians, animals)GLLSVLGSVVKHVIPHVVPVIAEHLLitoria caerulea (Green tree frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-,Antiviral26026377,15203252,PubMed ID is not available
DRAMP01560Caerin-1.9 (Frogs, amphibians, animals)GLFGVLGSIAKHVLPHVVPVIAEKLLitoria chloris (Blue-thighed frog) (frog skin active peptide family)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral26026377,16140737,15203252,9516047
DRAMP01574Caerin-4.1 (Frogs, amphibians, animals)GLWQKIKSAAGDLASGIVEGIKSLitoria caerulea (Green tree frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-,Antiviral15203252,PubMed ID is not available
DRAMP01577Caerin-1.10 (Frogs, amphibians, animals)GLLSVLGSVAKHVLPHVVPVIAEKLLitoria rothii (Roth's tree frog); also Litoria splendida (Magnificent tree frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-,Antiviral26026377,16124032,10601876
DRAMP01586Caerin-1.19 (Frogs, amphibians, animals)GLFKVLGSVAKHLLPHVAPIIAEKLLitoria gracilenta (Dainty green tree frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-,Antiviral26026377,16554081
DRAMP01784Temporin-LTc (Frogs, amphibians, animals)SLSRFLSFLKIVYPPAFHylarana latouchii (broad-folded frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral19022312
DRAMP01847Ascaphin-8 (Frogs, amphibians, animals)GFKDLLKGAAKALVKTVLFAscaphus truei (Coastal tailed frog)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral15207717
DRAMP02233Ranatuerin-6 (Frogs, amphibians, animals)FISAIASMLGKFLLithobates catesbeiana (American bullfrog) (Rana catesbeiana)Antimicrobial, Antibacterial, Anti-Gram+, Antiviral9784389
DRAMP02236Ranatuerin-9 (Frogs, amphibians, animals)FLFPLITSFLSKVLLithobates catesbeiana (American bullfrog) (Rana catesbeiana)Antimicrobial, Antibacterial, Anti-Gram+, Antiviral9784389
DRAMP02926Tachyplesin I (Tac; TP1; Horseshoe Crab, arachnids, Chelicerata, arthropods, invertebrates, animals)KWCFRVCYRGICYRRCRTachypleus tridentatus (Japanese horseshoe crab)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Anti-HIV, Anti-cancer12369825,2229025
DRAMP03113SK84 (Gly-rich; Insects, animals)SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHKDrosophila virilis (Fruit fly)Antimicrobial, Antibacterial, Anti-Gram+, Antifungal, Antiviral19799950
DRAMP03280AcAMP (A. clavatus antimicrobial peptide)ATYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCYCAspergillus clavatus ES1Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal20440534
DRAMP03422Neutrophil antibiotic peptide NP-4 (RatNP-4; Rodents, mammals, animals)ACYCRIGACVSGERLTGACGLNGRIYRLCCRRattus norvegicus (Rat)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal2543629,7594610
DRAMP03465Cicadin (Insects, animals)NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRKDDYNENYYDDVDAADVVCicada flammata Antimicrobial, Antifungal, Antiviral11814612
DRAMP03598Human beta-defensin 2 (hBD-2; Defensin, beta 2; Beta-defensin 4A; Human, mammals, animals)GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPHomo sapiens (Human)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral9202117,10906336,17340092
Close
Sign in     login

Forgot your password?