Result: 1 - 20 of 148
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP01746Temporin-L (Temporin-1Tl; temporin-Tl; TL; Frogs, amphibians, animals)FVQWFSKFLGRILRana temporaria (European common frog)Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic, Anticancer., Antimicrobial9022710
DRAMP18495Gomesin (Gm; Spiders, arachnids, Chelicerata, arthropods, invertebrates, animals)QCRRLCYKQRCVTYCRGRAcanthoscurria gomesiana (Tarantula spider) (Phormictopus pheopygus)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic, Antimalarial, Antic10942757
DRAMP02478L-amino-acid oxidase (Bm-LAO; LAAO; LAO; Snakes, reptiles, animals)IKFEPPLPPKKAHKKFWEDDGIYYPPNHNFPBothropoides matogrossensis (Pitviper) (Bothrops neuwiedimatogrossensis)Antibacterial, Antiparasitic, Anti-Gram+, Anti-Gram-, Antimicrobial22438972
DRAMP03150Gambicin (Insects, animals)MVFAYAPTCARCKSIGARYCGYGYLNRKGVSCDGQTTINSCEDCKRKFGRCSDGFITECFLAnopheles albimanus (mosquito)Antibacterial, Antifungal, Antiparasitic, Anti-Gram+, Anti-Gram-, Antimicrobial11606751
DRAMP03162Phlebotomus duboscqi defensin (PduDef; defensins; Insects, animals)ATCDLLSAFGVGHAACAAHCIGHGYRGGYCNSKAVCTCRRPhlebotomus duboscqiAntibacterial, Antifungal, Antiparasitic, Anti-Gram+, Antimicrobial15557638
DRAMP00252AdDLP (A. dehalogenans defensin-like peptide; Bacteriocin)VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESRAnaeromyxobacter dehalogenans (Gram-negative bacteria)Antibacterial, Antifungal, Antiparasitic, Antimicrobial19615342
DRAMP02310HbbetaP-1 (fish, chordates, animals)AANFGPSVFTPEVHETWQKFLNVVVAALGKQYHIctalurus punctatus (Catfish)Antibacterial, Antiparasitic, Antimicrobial18538841
DRAMP02418Longicin (Ticks, Arthropods, animals)GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRKHaemaphysalis longicornis (Tick)Antiparasitic, Antibacterial,Antifungal, Antimicrobial17485458
DRAMP02455L-amino-acid oxidase (ACL-LAO; LAAO; LAO)ADSRNPLEEEFRETNYEEFAgkistrodon contortrix laticinctus (Broad-banded copperhead)(Agkistrodon mokasen laticinctus)Antibacterial, Antiparasitic, Antimicrobial10441379
DRAMP02458L-amino-acid oxidase (BiLAO; LAAO; LAO; snakes, reptils, animals)ADDKNPLEECFREDDYEGFLEIAKNGLSTTSNPKRVVIVGAGMSGLAAYBothrops insularis (Golden lancehead) (Queimada jararaca)Antibacterial, Antiparasitic, Antimicrobial17983639
DRAMP02459L-amino-acid oxidase (BjarLAAO-I; LAAO; LAO; snakes, reptils, animals)ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVVBothrops jararaca (Jararaca)Antibacterial, Antiparasitic, Antitumor, Anti-Gram+, Antimicrobial18346051,19101583,20615423
DRAMP02460L-amino-acid oxidase (LAAO; LAO; snakes, reptils, animals)ADDRNPLEECFRETDYEEFLEIAKNGLSTTBothrops leucurus (White-tailed jararaca) (White-tailed lancehead)Antibacterial, Antiparasitic, Antimicrobial21539897
DRAMP02461L-amino-acid oxidase (BmarLAAO; LAAO; LAO; snakes, reptils, animals)AHDGNPLEECFREDDEEFFLEIAKNGLTATSNPKRVVIVBothrops marajoensis (Marajo lancehead)Antibacterial, Antifungal, Antiparasitic, Antimicrobial19944711
DRAMP02462L-amino-acid oxidase (LAAO; LAO; snakes, reptils, animals)DDRRSPLEECFQQNDYEEFLEIARNSQLYQESLREDSSYHLSFIESLKSDALFSYEKKFWEADGIHGGKVINDLSLIHDLPKREIQALCYPSIKKNaja oxiana (Central Asian cobra) (Oxus cobra)Antibacterial, Antiparasitic, Anti-Gram+, Anti-Gram-, Antimicrobial18294891
DRAMP02464L-amino-acid oxidase (LAAO, LAO; reptilia, animals)GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKPBitis gabonica (Gaboon adder) (Gaboon viper)Antibacterial, Antiparasitic, Antimicrobial15276202
DRAMP02465L-amino-acid oxidase L1 (LAAO; LAAO-L1; LAO; Reptiles, animals)ADDINPKEECFFEDDYYEFEDaboia russelii (Russel's viper) (Vipera russelii)Antibacterial, Antiparasitic, Antitumor, Antimicrobial18384385,20203422
DRAMP02466L-amino-acid oxidase L2 (LAAO; LAAO-L2; LAO; Reptiles, animals)ADDKNPLEECFCEDDDYCEGDaboia russelii (Russel's viper) (Vipera russelii)Antibacterial, Antiparasitic, Antitumor, Antimicrobial18384385
DRAMP02467L-amino-acid oxidase (LAAO; LAO; Reptiles, animals)ADDKNPLEECFREDDYEEFLEIAKNGLKKTSNPKHIVYPVKPSEQLYEESLRDQLPTSMHRYPSMIQKIFFAGEYTANAHGWIDSTIKVipera berus berus (Common viper)Antibacterial, Antiparasitic, Antitumor, Antimicrobial16574513
DRAMP02488L-amino-acid oxidase ACTX-8 (LAAO; LAO; Snakes, reptiles, animals)ADDRNPLEEFRENNYEEFLDeinagkistrodon acutus (Hundred-pace snake) (Agkistrodon acutus)Antibacterial, Antiparasitic, Antitumor, Antimicrobial17275856
DRAMP02512L-amino-acid oxidase (Casca LAO, LAAO, LAO; Snakes, reptiles, animals)ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAYVLSGGGHQVTVCrotalus durissus cascavella (Northeastern Brazilian rattlesnake)Antibacterial, Antiparasitic, Cytotoxic, Antimicrobial16307769
The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk.
Sign in     login

Forgot your password?