Result: 1 - 20 of 148
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP01746Temporin-L (Temporin-1Tl; temporin-Tl; TL; Frogs, amphibians, animals)FVQWFSKFLGRILRana temporaria (European common frog)Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic, Anticancer., Antimicrobial9022710
DRAMP18495Gomesin (Gm; Spiders, arachnids, Chelicerata, arthropods, invertebrates, animals)QCRRLCYKQRCVTYCRGRAcanthoscurria gomesiana (Tarantula spider) (Phormictopus pheopygus)Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic, Antimalarial, Antic10942757
DRAMP02478L-amino-acid oxidase (Bm-LAO; LAAO; LAO; Snakes, reptiles, animals)IKFEPPLPPKKAHKKFWEDDGIYYPPNHNFPBothropoides matogrossensis (Pitviper) (Bothrops neuwiedimatogrossensis)Antibacterial, Antiparasitic, Anti-Gram+, Anti-Gram-, Antimicrobial22438972
DRAMP03150Gambicin (Insects, animals)MVFAYAPTCARCKSIGARYCGYGYLNRKGVSCDGQTTINSCEDCKRKFGRCSDGFITECFLAnopheles albimanus (mosquito)Antibacterial, Antifungal, Antiparasitic, Anti-Gram+, Anti-Gram-, Antimicrobial11606751
DRAMP03162Phlebotomus duboscqi defensin (PduDef; defensins; Insects, animals)ATCDLLSAFGVGHAACAAHCIGHGYRGGYCNSKAVCTCRRPhlebotomus duboscqiAntibacterial, Antifungal, Antiparasitic, Anti-Gram+, Antimicrobial15557638
DRAMP00252AdDLP (A. dehalogenans defensin-like peptide; Bacteriocin)VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESRAnaeromyxobacter dehalogenans (Gram-negative bacteria)Antibacterial, Antifungal, Antiparasitic, Antimicrobial19615342
DRAMP02310HbbetaP-1 (fish, chordates, animals)AANFGPSVFTPEVHETWQKFLNVVVAALGKQYHIctalurus punctatus (Catfish)Antibacterial, Antiparasitic, Antimicrobial18538841
DRAMP02418Longicin (Ticks, Arthropods, animals)GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRKHaemaphysalis longicornis (Tick)Antiparasitic, Antibacterial,Antifungal, Antimicrobial17485458
DRAMP02455L-amino-acid oxidase (ACL-LAO; LAAO; LAO)ADSRNPLEEEFRETNYEEFAgkistrodon contortrix laticinctus (Broad-banded copperhead)(Agkistrodon mokasen laticinctus)Antibacterial, Antiparasitic, Antimicrobial10441379
DRAMP02458L-amino-acid oxidase (BiLAO; LAAO; LAO; snakes, reptils, animals)ADDKNPLEECFREDDYEGFLEIAKNGLSTTSNPKRVVIVGAGMSGLAAYBothrops insularis (Golden lancehead) (Queimada jararaca)Antibacterial, Antiparasitic, Antimicrobial17983639
DRAMP02459L-amino-acid oxidase (BjarLAAO-I; LAAO; LAO; snakes, reptils, animals)ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVVBothrops jararaca (Jararaca)Antibacterial, Antiparasitic, Antitumor, Anti-Gram+, Antimicrobial18346051,19101583,20615423
DRAMP02460L-amino-acid oxidase (LAAO; LAO; snakes, reptils, animals)ADDRNPLEECFRETDYEEFLEIAKNGLSTTBothrops leucurus (White-tailed jararaca) (White-tailed lancehead)Antibacterial, Antiparasitic, Antimicrobial21539897
DRAMP02461L-amino-acid oxidase (BmarLAAO; LAAO; LAO; snakes, reptils, animals)AHDGNPLEECFREDDEEFFLEIAKNGLTATSNPKRVVIVBothrops marajoensis (Marajo lancehead)Antibacterial, Antifungal, Antiparasitic, Antimicrobial19944711
DRAMP02462L-amino-acid oxidase (LAAO; LAO; snakes, reptils, animals)DDRRSPLEECFQQNDYEEFLEIARNSQLYQESLREDSSYHLSFIESLKSDALFSYEKKFWEADGIHGGKVINDLSLIHDLPKREIQALCYPSIKKNaja oxiana (Central Asian cobra) (Oxus cobra)Antibacterial, Antiparasitic, Anti-Gram+, Anti-Gram-, Antimicrobial18294891
DRAMP02464L-amino-acid oxidase (LAAO, LAO; reptilia, animals)GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKPBitis gabonica (Gaboon adder) (Gaboon viper)Antibacterial, Antiparasitic, Antimicrobial15276202
DRAMP02465L-amino-acid oxidase L1 (LAAO; LAAO-L1; LAO; Reptiles, animals)ADDINPKEECFFEDDYYEFEDaboia russelii (Russel's viper) (Vipera russelii)Antibacterial, Antiparasitic, Antitumor, Antimicrobial18384385,20203422
DRAMP02466L-amino-acid oxidase L2 (LAAO; LAAO-L2; LAO; Reptiles, animals)ADDKNPLEECFCEDDDYCEGDaboia russelii (Russel's viper) (Vipera russelii)Antibacterial, Antiparasitic, Antitumor, Antimicrobial18384385
DRAMP02467L-amino-acid oxidase (LAAO; LAO; Reptiles, animals)ADDKNPLEECFREDDYEEFLEIAKNGLKKTSNPKHIVYPVKPSEQLYEESLRDQLPTSMHRYPSMIQKIFFAGEYTANAHGWIDSTIKVipera berus berus (Common viper)Antibacterial, Antiparasitic, Antitumor, Antimicrobial16574513
DRAMP02488L-amino-acid oxidase ACTX-8 (LAAO; LAO; Snakes, reptiles, animals)ADDRNPLEEFRENNYEEFLDeinagkistrodon acutus (Hundred-pace snake) (Agkistrodon acutus)Antibacterial, Antiparasitic, Antitumor, Antimicrobial17275856
DRAMP02512L-amino-acid oxidase (Casca LAO, LAAO, LAO; Snakes, reptiles, animals)ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAYVLSGGGHQVTVCrotalus durissus cascavella (Northeastern Brazilian rattlesnake)Antibacterial, Antiparasitic, Cytotoxic, Antimicrobial16307769
Close
Sign in     login

Forgot your password?